SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_853616.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_853616.1.92730
Domain Number 1 Region: 349-456
Classification Level Classification E-value
Superfamily SH2 domain 1.16e-31
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 54-162
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-31
Family SH2 domain 0.00000174
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_853616.1.92730
Sequence length 461
Comment phosphatidylinositol 3-kinase regulatory subunit gamma [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTPAVTNGMKDSFISL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSEPLTFTSVVELINHYHHESLAQYNPKLDVKLTYPVSRFQQDQLVKEDNIDAVGKN
LQEFHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKDY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKLRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHRGVRQRRLNAWLGIKNEDSDESYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPTLCR
Download sequence
Identical sequences Q3UXE9 Q64143
ENSMUSP00000030464 10090.ENSMUSP00000030464 NP_853616.1.92730 XP_017175528.1.92730 XP_017175529.1.92730 ENSMUSP00000030464 ENSMUSP00000102099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]