SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_859048.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_859048.1.87134
Domain Number 1 Region: 7-197
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.56e-74
Family Glutathione peroxidase-like 0.0000000318
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_859048.1.87134
Sequence length 199
Comment peroxiredoxin-1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFS
DRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLK
ADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPG
SDTIKPDVQKSKEYFSKQK
Download sequence
Identical sequences H2PYX4 Q06830
NP_001189360.1.87134 NP_001189360.1.92137 NP_002565.1.87134 NP_002565.1.92137 NP_859047.1.87134 NP_859047.1.92137 NP_859048.1.87134 NP_859048.1.92137 XP_001156568.1.37143 XP_003308110.1.37143 XP_003812829.1.60992 XP_016817283.1.37143 Hs4505591___KOG0852 ENSPTRP00000001167 ENSP00000262746 ENSP00000361152 gi|320461711|ref|NP_001189360.1| gi|32455264|ref|NP_859047.1| gi|32455266|ref|NP_859048.1| gi|4505591|ref|NP_002565.1| 9598.ENSPTRP00000001167 9606.ENSP00000262746 ENSP00000262746 ENSP00000262746 ENSP00000361152 ENSPTRP00000001167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]