SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_864306.1.48053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_864306.1.48053
Domain Number 1 Region: 370-481
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000942
Family Dual specificity phosphatase-like 0.034
Further Details:      
 
Weak hits

Sequence:  NP_864306.1.48053
Domain Number - Region: 235-293
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.1
Family Laminin G-like module 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_864306.1.48053
Sequence length 504
Comment secreted glycosyl hydrolase [Rhodopirellula baltica SH 1]; AA=GCF_000196115.1; RF=reference genome; TAX=243090; STAX=265606; NAME=Rhodopirellula baltica SH 1; strain=1; AL=Complete Genome; RT=Major
Sequence
MRKGSIGGITGYHWRCVPPTPISPPFDEPYRMNLSRQLPLDRSRQTYRRARALPLKSPAI
DGQLIAAGREPSGSPSPKPRRTTLALLATILLTASQLSPTFAADPAAGTPRDTPAGAESL
LEGNLADSWEGSLDDWTLENGVLIGTTDGSVKVNRFITSKIAPVEDFELEVDVWVSARGN
SGIQYRSEVREDLGPNVMVGYQCDVVAATPKYNGMLYEERGRRILCHTAEKVVTDADGQG
WVVESSEPPKFAPEAWHRYKVRVVGNHHQHWIDGQKTAEHFDLDPNGRSLSGRIGVQVHV
GPPMEIRYRNFFVKRLTPTTPPSDSMEIPADAKKIVPQGGWKNAGKRDANHKLVKAELPG
TRKVHRAGPIWLAGQPTAEGLAAAKKAGVKRVITLRSERELDFDDEALVKNAGLEFHAIR
FGGHQQLTDEKIHAVCQLLQAADPDNQALLHCASANRVGAIWIAYRVLDGRQTLENAIQE
GKQVGLLDPDLEKAAVEYVKQRKR
Download sequence
Identical sequences Q7UXM1
NP_864306.1.48053 gi|32471313|ref|NP_864306.1| 243090.RB1240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]