SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_864735.1.48053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_864735.1.48053
Domain Number 1 Region: 371-419
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000122
Family Leech intramolecular trans-sialidase, N-terminal domain 0.043
Further Details:      
 
Weak hits

Sequence:  NP_864735.1.48053
Domain Number - Region: 35-46,73-193,231-258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0389
Family Legume lectins 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_864735.1.48053
Sequence length 421
Comment hypothetical protein RB2088 [Rhodopirellula baltica SH 1]; AA=GCF_000196115.1; RF=reference genome; TAX=243090; STAX=265606; NAME=Rhodopirellula baltica SH 1; strain=1; AL=Complete Genome; RT=Major
Sequence
MQRIIFVLIAAFTSAMSDGTLSAFDPPLNRDVVRSTPGLVAFWDFDLRESSGNERFIAHV
PSGSSDNYPLDAANYVRDYWGEGRQATYADFPLLNDGPFGQAIRIREESDPNFRPFLFIP
RSRLHDTPLDIKGDGKSVTVVVWAIRESGNHALAGIWHEGTDLKQSSTASIKKVERGQRQ
YALFAGLNKPGSACGHVSENGASSFLNKYALHKCNSLGQSPAVAADSSPEKLAASWQCFA
MTFDNENNEITGWLNGISGERWLMNPKSNNLLSYAHNAYLQGHYARTPGTQEGEDSDFPK
AQYYNPPEGEASEVEVLREDENQRVERRRYRYTEVVVTLEKDGVGEWGETGRDLVGLRLN
PWWYPHGIYSPPDAEQGGPFTIGRVIHSSRSVGFTGWIGGVSVFDRALSEAELKTLADLR
N
Download sequence
Identical sequences Q7UWE6
NP_864735.1.48053 243090.RB2088 gi|32471742|ref|NP_864735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]