SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_871668.1.50509 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_871668.1.50509
Domain Number - Region: 88-148
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0204
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_871668.1.50509
Sequence length 224
Comment Uncharacterized protein CELE_Y119D3B.12 [Caenorhabditis elegans]; AA=GCF_000002985.6; RF=reference genome; TAX=6239; STAX=6239; NAME=Caenorhabditis elegans; strain=Bristol N2; AL=Complete Genome; RT=Major
Sequence
MTDYMAQMLNELMGSQRDANPGERREIRYDDPNVCTDFLVGFCTHDIFRNTKNDLGFCKY
TTHDENLKNSYKNSDKKWRMGFEKRFLERIRRIHEDVRRKIQKHEDRLAVTQGESKSAEE
TFGQKILEIEQRREQLTKKMEDLMDEAALEGEKGNVDAAQTAVDRADKAKVEVEELTQEA
EKLKSEKERAINMEENVTAAPLDRRRRRRAGTQNSPNFCTIFSC
Download sequence
Identical sequences Q8IAB4
Y119D3B.12b Y119D3B.12b NP_871668.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]