SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_899001.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_899001.1.92730
Domain Number 1 Region: 335-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.54e-30
Family SPRY domain 0.0024
Further Details:      
 
Domain Number 2 Region: 157-267
Classification Level Classification E-value
Superfamily Fibronectin type III 4.33e-17
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_899001.1.92730
Sequence length 496
Comment fibronectin type III and SPRY domain-containing protein 1 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MEDQREALRKIITTLAMKNEETQTFIYSLKQMLLNVEANSAKVQEDLEAEFQSLTSVLEE
LKESMLMKIKQDRASRTYELQNQLAACTRALESSEELLETANQTLQASDSEDFSQAAKEI
KDGITMAPAFRLSLKAKVSDNMSHLMVDFAQERQMLQALKFLPVPSAPTIDLAESLVSDN
CVTLVWHMPDEDSKIDHYVLEYRKTNFEGPPRLKEDHPWMVVEGIRQTEHTLTGLKFDMK
YMNIRVKACNKAVAGEFSEPVTLETPAFMFRLDGSTSHQNLRVEDLSAEWDAMGGKVQDI
KAREKEGKGRTASPVNSPARGTPSPKRMSSGRGGRDRFTAESYTVLGDTLIDGGEHYWEV
RFEPDSKAFGLGVAYRSLGRFEQLGKTAASWCLHANNWLQASFTAKHANKVKVLDSPVPD
CLGVHCDFHQGLLSFYNARTKQLLHTFKAKFTQPLLPAFTVWCGSFQVTTGLQVPSAVRC
LQKRGSATSSSNTSLT
Download sequence
Identical sequences Q7TPM6
ENSMUSP00000011733 NP_899001.1.92730 10090.ENSMUSP00000011733 ENSMUSP00000011733 ENSMUSP00000011733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]