SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_899107.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_899107.1.92730
Domain Number 1 Region: 37-86
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000333
Family Ovomucoid domain III-like 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_899107.1.92730
Sequence length 86
Comment serine protease inhibitor Kazal-type 2 isoform 2 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MLRLVLLLLVTDFAASHETLDSSDSQIMKRSQFRTPDCGHFDFPACPRNLNPVCGTDMNT
YSNECTLCMKIREDGSHINIIKDEPC
Download sequence
Identical sequences Q8BMY7
NP_899107.1.92730 ENSMUSP00000067117 10090.ENSMUSP00000067117 ENSMUSP00000067117 ENSMUSP00000067117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]