SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_923140.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_923140.1.44878
Domain Number 1 Region: 7-192,244-383
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.1e-74
Family TK-like PP module 0.0078
Further Details:      
 
Domain Number 2 Region: 318-509
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 7.85e-63
Family TK-like Pyr module 0.027
Further Details:      
 
Domain Number 3 Region: 495-628
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 8.9e-40
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_923140.1.44878
Sequence length 638
Comment 1-deoxy-D-xylulose-5-phosphate synthase [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MNLSDLSHPNQLRDLSVSQLGRLAQQIRDKHLQTVAATGGHLGPGLGVVELTLALYKTLD
LDRDRVVWDVGHQAYPHKMLTGRYANFHTLRQKDGLAGYLKRAESPFDCWGAGHASTSIS
AALGMALARDFQGLNRKVVAIIGDGALTGGMALEALNHAGHLSKTNLMVILNDNEMSISE
NVGGLSLYLNRLRTDPALRQIRSNLETQLRNIPLVGPTFSPEFERFKDTVKYMTMTRSKA
GVIFEELGFTYLGPIDGHNLGDLIETFEFAHSLPGPVFLHAITVKGKGYEVAEQNQIKYH
AQSAFDLATGKAKPASKPTPPAYTSVFAQTLVKLAEQNEKIVGITAAMPTGTGLDKFKER
FADRYFDVGIAEQHAVTMAAGLAADGMRPVAAIYSTFLQRAFDQIIHDVAIQDLPVFFCL
DRAGVVGEDGPTHHGVFDLAYLRQIPGLVVMAPKDEAELQRMMVTGIQYTKGPIAVRYPR
GSGSGAPLMAEGWDPVPIGKAEVLRSGDDLLIVAIGTMVHPSLQAAALLSEHGIDATVVN
ARFAKPLDTELLLPLARRIGRVVTVEEGCRMGGFGSAVLEALMDGGIAVPTLRIGIDDKF
VTHAGRSQLLDLLGLTPSGIAKTIRESLSTEPVSAPRA
Download sequence
Identical sequences Q7NP63
NP_923140.1.44878 251221.gll0194 gi|37519763|ref|NP_923140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]