SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_924704.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_924704.1.44878
Domain Number 1 Region: 8-270
Classification Level Classification E-value
Superfamily Pentein 2.75e-51
Family Dimethylarginine dimethylaminohydrolase DDAH 0.027
Further Details:      
 
Weak hits

Sequence:  NP_924704.1.44878
Domain Number - Region: 616-688
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 0.000563
Family Pyruvate oxidase and decarboxylase, middle domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_924704.1.44878
Sequence length 692
Comment hypothetical protein glr1758 [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MRSGLRYLMCSPTHYEVDYIINPWMEGNVHRSSREEAARQWEGLHKILDELADVQLVEPA
PGWPDMVFTANAGLVLDKNVVLSRFFHPERQGEEPHFREWFEAQGYVVCELPTKIAFEGA
GDALLDREGRWLWAGYGFRSSLESHPYLAKYLDIEVLSLRLVDERFYHLDTCFCPLSDGY
LLYYPPAFDDTSNRLIESRVSPDKRLVVGEVDAVNFACNAVNVERTVIVNQVTPGLAARL
ASCNFAVRETPLSEFLKAGGAAKCLTLRLTEPRTVEMPQVQVATRNVEMQGHLLDSALMT
EVIDLILKGGASFQILDFKVGQRRQDTSYTRLQVTAPTAETLESVLTQLIDRGAVLAEEA
VRDAELQAATQDGVAPQDFFVTSIYPTEVRLGGRWVVVAHQRMDGAIVVEPETGTARCAL
LRDIKAGERVVTGVEGIRTRHQKALPDREREEFSFMASGVSSERRVELVVEQVAWQLRRL
RTQGGKAVVVAGPVVIHTGGGAHLANLIREGYVQALLGGNAIAVHDIEQAFHGTSLGVDL
QRGVVIQGGHRHHLKTINLIRRCGSIAAAVEQGVLHSGIFYECVKAGVPFSLAGSIRDDG
PLPDTEMDLIQAQTDYARLIEGADLILMLSSMLHSIGVGNMTPAGVKLVCVDINPAVVTK
LADRGSVESVGVVTDVGLFLSLLVRQLHYLDH
Download sequence
Identical sequences Q7NJS4
gi|37521327|ref|NP_924704.1| 251221.glr1758 NP_924704.1.44878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]