SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_925750.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_925750.1.44878
Domain Number 1 Region: 355-534
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.95e-60
Family Pyruvate oxidase and decarboxylase PP module 0.0000572
Further Details:      
 
Domain Number 2 Region: 1-165
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.99e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000262
Further Details:      
 
Domain Number 3 Region: 180-360
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.12e-42
Family Pyruvate oxidase and decarboxylase, middle domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_925750.1.44878
Sequence length 545
Comment acetolactate synthase [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MNTAELLVQCLENEGVRYIFGLPGEENMQFLEALQSSSIQFVTTRHEQGAAFMADVYGRL
TGRAGVCLSTLGPGATNLMTGVADANLDRAPLVAITGQVGTDRMHVDAHQYLDLVAMFAP
VTKWSTHIVRPSNTPEIVRKAFKIAQAEKPGAVHIELPENIASMAAIGEPLRISDNHDIF
ASFSSITRAAELISQADNPLILVGNGAIRCNASAALTEFAARLNIPVANTFMGKGVIPYT
HPLALWAVGLQQRDYISCGFDRADLVIAIGYDHIEYSPKKWNPMGDIPIVHVGRTAAEVD
SSYIPQVEVVGDISDSLQEILSRADRQGKPDPYAIQLRDDIRAEYTEYAHDTGYPVKPQK
IIYDLRQVLGSEDILISDVGAHKMWVARHYHCDRPNTCIISNGFAAMGIAIPGAVAAKLV
HPHRKVVAVTGDGGFMMNMQELETALRIGTPFVTLIFNDGGYGLIEWKQQTHFNRSAFVR
FGNPDFVRLAESMGLKGYRVEAGDELLPILKTALEQEVPAIIDCPVDYRENMELSQRVMQ
LSCAV
Download sequence
Identical sequences Q7NGT4
NP_925750.1.44878 gi|37522373|ref|NP_925750.1| 251221.gvip386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]