SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_926144.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_926144.1.44878
Domain Number 1 Region: 3-574
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 3.53e-187
Family Prokaryotic type I DNA topoisomerase 0.000000000697
Further Details:      
 
Domain Number 2 Region: 582-624
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000204
Family PhnA zinc-binding domain 0.063
Further Details:      
 
Weak hits

Sequence:  NP_926144.1.44878
Domain Number - Region: 669-705
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0104
Family PhnA zinc-binding domain 0.064
Further Details:      
 
Domain Number - Region: 702-731
Classification Level Classification E-value
Superfamily RNA polymerase subunits 0.0811
Family RBP12 subunit of RNA polymerase II 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_926144.1.44878
Sequence length 765
Comment DNA topoisomerase I [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MSKSLVIVESPAKAKTISKILGKNFVVKASAGHIRDLPQKEMGVNVKNDFEPKYVIIPKK
EEVVEELKGAARNADRVYLAPDPDREGEAIAWHLAQILDIPGDRLQRIEFHEITKQAIQN
AVAHPRDIDINRVDAQQARRILDRLVGYKLSPLLWKKVQRGLSAGRVQSVAVRLLCDREK
EIQAFVSEEYWTVHGRFRQSAQVEATPFSADLVRWSGKKPDLGNETAARAVVEVLTGAAS
RVDSVKTRERQKEPQPPFITSTLQREGASALGLTVKRTMAIAQQLYEGIDLGEEGPVGLI
TYMRTDSTRVAEEAQEAAREFILAAYGKSYYPSRRRQYGAKKGAQDAHECVRPTDINRPP
DAIKKSLTPDQFKLYRLIWQRFTASQMTAATLETRTVEIAATPTAGRPDALFRVSVTRTI
FDGYTRVYEEAREEAATGDEEAAGAAPVLEEGEALTLLTVDPKQHFTQPPARFSEATLVK
ALEEQGIGRPSTYAPTIGTIQERGYVNKDGRTLIPTDLGMKVNDQLVQHFPNIVDTEFTA
NMEAQLDEVEKGSQRWTQLLADFYGPFVETLKAADEEMKRVVIVTDHLCESCGRPLLNRY
GRFGNFLGCSGYPECDFTHQLTRDNKPVPKDRPAEGISCNQCGHAPMLITYGRYGEYLKC
PACGKSQPKSTGITCPKCSKGQIVERRSKMGKNFYGCDQYPDCDFVLWSRPIDKPACPEC
GSILLYKPRKRGDDMVACSACKFTAPAQEMVGEEEVERQAELLTG
Download sequence
Identical sequences Q7NGH1
NP_926144.1.44878 gi|37522767|ref|NP_926144.1| 251221.gvip441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]