SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_926308.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_926308.1.44878
Domain Number 1 Region: 202-295
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 5.1e-24
Family Electron transfer flavoprotein-ubiquinone oxidoreductase-like 0.00024
Further Details:      
 
Domain Number 2 Region: 3-202,298-391
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.42e-19
Family FAD-linked reductases, N-terminal domain 0.0018
Further Details:      
 
Domain Number 3 Region: 509-568
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00000027
Family 7-Fe ferredoxin 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_926308.1.44878
Sequence length 572
Comment electron transfer flavoprotein-ubiquinone oxidoreductase [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MSPPIRYDLLLVGGSASNLILAHRLLDLAGKSGLPLTIALVEKSAQFGAHIVSGALTKTH
VLEKVFPDFKTNGFPIEGYVTHSHLSVLGSEERWDLPHAIVPKGFRKEGHAILTLSHAIR
WLAEQLQAKAKELPNVLLDVFPGFAAQEILYEDQRVAGVRVSASGDVFEDAIFAEFTCFG
DKGFLSKDLVERFALRPNPQLWSVGIKEVWEVDLDCRGVVWHTLGYPILDGTFSGGFVYG
LGHKKLAIGLVISLDSKNPNLNPQLRLQQFKAHPWIQELIQGGRLLKYGAAVIPEGGYYS
LPTRFGVEGALLLGDALGVLDAASLSGLDKSMETGYVAAELLHGAFVDRNFEGLTERYKS
AVMDGFIGQELYASRHFRRAFLENDRLLGEYLPAVCQSVDQGHPWLGSLKFGLGKPIQRS
TDTFQALGLILGRISGDKIFRYTPCHENIEPAFTQPAVAVSTQARPETLLSRPDAVFFAA
PRYHEGNRHIEEFDADTCRRCIAVYDRLGKPTPCIADCTAEVHRIDEAGGVRVHGMSLEN
CIQCRTCEIVCPSVNLRVNPTYEGSGPDFYGL
Download sequence
Identical sequences Q7NG12
NP_926308.1.44878 gi|37522931|ref|NP_926308.1| 251221.gll3362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]