SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_926634.1.44878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_926634.1.44878
Domain Number - Region: 41-83
Classification Level Classification E-value
Superfamily TolA/TonB C-terminal domain 0.00053
Family TolA 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_926634.1.44878
Sequence length 341
Comment hypothetical protein gll3688 [Gloeobacter violaceus PCC 7421]; AA=GCF_000011385.1; RF=reference genome; TAX=251221; STAX=33072; NAME=Gloeobacter violaceus PCC 7421; strain=PCC 7421; AL=Complete Genome; RT=Major
Sequence
MRWLEVAAMMMSFVRSLLLFSGLMVYSASVGTAAELPTGRLAREAVQAQWKLPRLKTDGT
VTVKAKLLSDGHLIDPQLTLGGPLAIEGGEAAELTRRSLEEAIRRAVVDTASRGPVEFTL
QIRSSGRVPGCFPLRVALPVALKDTQETIPEVLFKGLEQGLIKWNAMVVGYAEGKLPEPL
VVVPSPEQADVVVEAFEDYPDYSSYFIDERSGRVVVRMPFKRDVGAWVTQGFRWWHPEQI
TQQTMFQLGRQMGLGLSENNTNVLYPDQSLTIVTSPQKGLGVGTRNVQTIIDGNLVNEYG
GGDRTITSFQLEDAGDFVRTRRCAAERAPASPNVINRPETP
Download sequence
Identical sequences Q7NF38
251221.gll3688 NP_926634.1.44878 gi|37523257|ref|NP_926634.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]