SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_954984.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_954984.1.92137
Domain Number - Region: 179-213
Classification Level Classification E-value
Superfamily UBA-like 0.00548
Family UBA domain 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_954984.1.92137
Sequence length 215
Comment nascent polypeptide-associated complex subunit alpha-2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEID
EEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAY
IVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKD
VKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Download sequence
Identical sequences Q9H009
ENSP00000427802 NP_954984.1.87134 NP_954984.1.92137 ENSP00000427802 gi|40548328|ref|NP_954984.1| GO.46346 HR4845 ENSP00000427802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]