SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_955824.2.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_955824.2.45394
Domain Number 1 Region: 32-333
Classification Level Classification E-value
Superfamily WD40 repeat-like 5e-45
Family WD40-repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_955824.2.45394
Sequence length 1250
Comment protein transport protein Sec31A [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MKLKEINRTAIQAWSPAQQHPIYLAAGTSAQQLDATFSTNASLEIFELDLADSALAMKSC
GSFSSPHRYHKLVWGPHGIENQGLPSGVLIAGGENGNIILYDASKIIAGDSEVIILQSEK
HTGAVRALDVNSFQSNLVASGGNESEIYIWDLNNFSSPMTPGPKTQPQEDISCVAWNKQV
QHILASASPSGKASVWDLRKNDLIIKVSDHSNRMHCSGLAWNPEVATQLVLASEDDRMPV
IQMWDLRFATSPLKVLENHTRGILAIAWSVADPELLLSCGKDNRILCWNPNTAEVLYELP
TSTQWCFDIQWCPRNPAVLSAAAFDGHISIYSIMGGSNDNANNLQADQLSSSFGNMDPFG
TGKTLPPLQLPQQTSPQSTITPLKKPPKWIRRPVGASFAFGGKLVTLDNIKPTAQQPQQT
AAHVVHISQVVTETDFIHRSNQLQTTLNAGNFLEYCQNKIETVQNEFERTVWSFLKVNFE
EDARLKYLELLGYEKEELALKIASALEGNCKPKEADMDKEEVLAEEEADSDLDDIPVNEE
EPVVEETSNTEVPPAPASDAINLKVSQDIDGLITQALLTGDYEAAVNLCLHDNRMADGII
LAIAGGPELLAKTQRKYFSKTESKISKLISAVVMKDWLDILETCDLQNWKEALAAVMTYA
KPEEFSALCGLLGSRLESSEDVELQAQACLCYICAGTVEQLVSFWTKTQDSCSPLSLQEL
VEKVVVLQRAVEKAQGAVPADMGALLAEKMNQYASLLASQGSLQTAISYLPTNTEQVSVQ
QLRERLSRALGQHQHPQQPAAAVTGIQKMHQTRPAAVPMQTYSQPQPPAQPAAPAVPPQY
YQQGRSATTVTSWSNQTPTALPSVPRQLVPSSDPQGDSTPPAFGLQSPAMASVPASTPFM
YSQQYQNYPPVQQFTPSAGTPGIYQPLPYASSAGSPLPPPPSSSSAAVYPPQFMLSASSQ
ASAPPQSFCPPPAVSSGGCFQHGGPGSPTSYLPPPGARAPGTQHEPALIPASQRTDGFYQ
ETAWGLEGPQNGWNDPPALSRAAKKKKVPQHFTPPAPITAPIMAPLGDPQAPAGMQTLQP
QQQVPDQSAGPATFTPIQQQPLGPRNPSMPQGNMEGAPGAPIGDVIKPLQAIPTEKITKK
PIPEEHMVLKTTFEGLIQKCLTAASDPQTKRKLDDAHKRLELLYDKLREQTLSPAIIGGL
HNMAHSIECRSYADGLNIHTHIVSNSNFSETSAFMPVLKVVLTQANKLGV
Download sequence
Identical sequences F1R5G5
ENSDARP00000104171 ENSDARP00000104171 NP_955824.2.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]