SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_956012.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_956012.1.45394
Domain Number 1 Region: 153-239
Classification Level Classification E-value
Superfamily F-box domain 3.66e-17
Family F-box domain 0.0037
Further Details:      
 
Domain Number 2 Region: 62-97
Classification Level Classification E-value
Superfamily MIT domain 0.00000837
Family MIT domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_956012.1.45394
Sequence length 421
Comment F-box only protein 9 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MAESNQNTDGAVEEGEDENTGDSNLQMELSAFRAKWMSELQPSSGGQRSFSRNAELRRRQ
ETAKEEKARELFLKAVEEEQNGAVYEAIKYYKSAMQLVPDIEFKINYSRTPDPERGGSYL
ESSENNREIDDLLTYFQHQLTLGNDAMKLCEHETETSQVHISALPFEVLMYIFRWVVSCD
LDLRALEQLSLVCRGFYICARDPEIWRSACLRVWGRSCTKMLPYSSWREMFLERPRVRFD
GVYISKTSYIRQGEESLDGFYRAWHQVEYYRYLRFFPDGQVMMLTTPEDPLVTVPRLRSK
NSRMDSIMFGHYRLSQDTDNQTKVYVVVSKRKEEKVSEYQRSRFCRRNPVPEAERSFHVG
LQLSSGGRQRFNKLVWIHHSCHITYRSTGETVVTAFDVDKMYTPLFFARVKSYTAFSERP
L
Download sequence
Identical sequences Q6P3K3
ENSDARP00000093542 7955.ENSDARP00000093542 NP_956012.1.45394 ENSDARP00000093542 GO.79424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]