SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_957272.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_957272.1.45394
Domain Number 1 Region: 335-645
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.13e-89
Family Protein kinases, catalytic subunit 0.0000000137
Further Details:      
 
Domain Number 2 Region: 155-281
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-37
Family Synaptotagmin-like (S variant) 0.00000489
Further Details:      
 
Domain Number 3 Region: 24-86
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.89e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0027
Further Details:      
 
Domain Number 4 Region: 97-153
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.49e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_957272.1.45394
Sequence length 670
Comment protein kinase C beta type [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MAEPANSDGEERSAPMRGFARQGALRQKNVHEVKNHKFIARFFKQPTFCSHCTDFIWGFG
KQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKVHTYSSPTFCDHCGSL
LYGLIHQGMRCDHCMMNIHKRCVANVPSLCGTDHTERRGRIQITAEIKNNVLTVSIKEAK
NLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCCLNPTWNETFTFNLKESDKDRRLS
VEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEEL
RQKFERAKIGPSKTDGSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKG
ADELFAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYI
NGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGVIYRDLKLDNVMLDAEGHIKIA
DFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDG
EDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYM
DWEKLEHREVQPPFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIMNLDQDEFEGFSFIN
PEFPAMEAQS
Download sequence
Identical sequences Q7SY24
7955.ENSDARP00000038918 ENSDARP00000038918 ENSDARP00000038918 NP_957272.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]