SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_957717.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_957717.1.92137
Domain Number 1 Region: 37-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000000111
Family Ubiquitin-related 0.0000712
Further Details:      
 
Domain Number 2 Region: 333-376
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000766
Family UBA domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_957717.1.92137
Sequence length 380
Comment ubiquitin-like protein 7 isoform a [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPEL
IDLIYCGRKLKDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTAL
HSSSSYREAVFKMLSNKESLDQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVP
AHPALVNAIVLVLHSVAGSAPMPGTDSSSRSMPSSSYRDMPGGFLFEGLSDDEDDFHPNT
RSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALASTPESSSHTPTPGTQGHSSGT
SPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGIQDDELSLRAL
QATGGDIQAALELIFAGGAP
Download sequence
Identical sequences Q96S82
9606.ENSP00000354883 NP_001273668.1.87134 NP_001273668.1.92137 NP_001273669.1.87134 NP_001273669.1.92137 NP_116296.1.87134 NP_116296.1.92137 NP_957717.1.87134 NP_957717.1.92137 gi|14249682|ref|NP_116296.1| gi|41152107|ref|NP_957717.1| ENSP00000354883 ENSP00000354883 ENSP00000378518 ENSP00000454828 ENSP00000457703 ENSP00000457708 ENSP00000354883 ENSP00000378518 ENSP00000454828 ENSP00000457703 ENSP00000457708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]