SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_973724.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_973724.1.92137
Domain Number 1 Region: 135-254
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.29e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.000000366
Further Details:      
 
Weak hits

Sequence:  NP_973724.1.92137
Domain Number - Region: 274-296
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000314
Family Retrovirus zinc finger-like domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_973724.1.92137
Sequence length 638
Comment splicing factor 1 isoform 2 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIED
LTRKLRTGDLGIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALN
PDFKPPADYKPPATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGK
GSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNILKQGIETPEDQNDLR
KMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP
QSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPANNPPPPSLMS
TTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP
PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPP
PPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQNTTTTTTSAGTGS
IPPWQQQQAAAAASPGAPQMQGNPTMVPLPPGVQPPLPPGAPPPPPPPPPGSAGMMIPPR
GGDGPSHESEDFPRPLVTLPGRQPQQRPWWTGWFGKAA
Download sequence
Identical sequences A0A024R5D9 A0A2K5K7L1 A0A2K5KSC0 A0A2K5SIG7 A0A2K5V8U3 B0CM65 B0KWK3 E2RRT4 F6Z6Z8 H2Q406
ENSCAFP00000021003 ENSCJAP00000005112 ENSP00000334414 NP_973724.1.87134 NP_973724.1.92137 XP_001166699.2.37143 XP_004437627.1.5094 XP_005227223.1.76553 XP_005577426.1.63531 XP_005631569.1.84170 XP_007991638.1.81039 XP_011797949.1.43180 XP_011897206.1.92194 XP_011972518.1.54773 XP_017392687.1.71028 XP_017833731.1.60252 XP_017898369.1.57651 XP_020747442.1.74333 ENSPANP00000001595 gi|42544125|ref|NP_973724.1| ENSCAFP00000021003 ENSCJAP00000044970 ENSP00000334414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]