SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_976086.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_976086.1.87134
Domain Number 1 Region: 73-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000076
Family Selenoprotein W-related 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_976086.1.87134
Sequence length 124
Comment 15 kDa selenoprotein isoform 2 precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MVAMAAGPSGCLVPAFGLRLLLATVLQAVSAFGAEFSSEACRELGFSSNLLCSSCDLLGQ
FNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQVCPWFRPCIKAFGRQ
WEHC
Download sequence
Identical sequences NP_976086.1.87134 NP_976086.1.92137 XP_008967930.2.60992 gi|42741650|ref|NP_976086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]