SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_989752.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_989752.1.86415
Domain Number 1 Region: 141-396
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-71
Family Nuclear receptor ligand-binding domain 0.00000762
Further Details:      
 
Domain Number 2 Region: 72-154
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.01e-31
Family Nuclear receptor 0.000087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_989752.1.86415
Sequence length 410
Comment COUP transcription factor 2 [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MAMVVGAWRDPQDDVPGAQGTQPAPAPPVQGPPAGTPHTPQTPGPGGPPSTPAQSNAASQ
QSQGDKQQQQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLSYTCRANRNCPID
QHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPTHGQFALTNGDPLNCHSYLSGYISL
LLRAEPYPTSRFGSQCMQPNNIMGIENICELAARMLFSAVEWARNIPFFPDLQITDQVAL
LRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKA
LHVDSAEYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRFGKLL
LRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQ
Download sequence
Identical sequences A0A226NNI5 Q90733
NP_989752.1.86415 XP_010725865.1.16129 XP_015728620.1.68032 ENSGALP00000011318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]