SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_990774.2.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_990774.2.86415
Domain Number 1 Region: 160-420
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.36e-82
Family Eukaryotic proteases 0.00000512
Further Details:      
 
Domain Number 2 Region: 57-167
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-22
Family Kringle modules 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_990774.2.86415
Sequence length 434
Comment urokinase-type plasminogen activator preproprotein [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MKLIIFLTVTLCTLVTGLDSVYIRQYYKLSHKHRPQHRECQCLNGGTCITYRFFSQIKRC
LCPEGYGGLHCEIDTNSVCYSGNGEDYRGMAEDPGCLYWDHPSVIRWGDYHADLKNALQL
GLGKHNYCRNPNGRSRPWCYTKRRYSIQETPCSTIEKCERTCGQRSFSKYFKIVGGSQAE
VETQPWIAGIFQNIMGTDQFLCGGSLIDPCWVLTAAHCFYNPTKKQPNKSVYKVFLGKSI
LNTNDEHEQVFMVDEIISHPDFTDHTGGNDNDIALIRIRTASGQCAVESNYVRTVCLPEK
NLNLYDNTWCEIAGYGKQNSYDIYYAQRLMSATVNLISQDDCKNKYYDSTRVTDNMVCAG
DPLWETDACKGDSGGPMVCEHNGRMTLYGIVSWGDGCAKKNKPGVYTRVTRYLNWIDSNM
NAVFTKSRSFREPK
Download sequence
Identical sequences F1NYX5
ENSGALP00000008143 9031.ENSGALP00000008143 ENSGALP00000008143 ENSGALP00000042397 NP_990774.2.86415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]