SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_991182.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_991182.1.45394
Domain Number 1 Region: 23-81
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000107
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 
Weak hits

Sequence:  NP_991182.1.45394
Domain Number - Region: 86-111
Classification Level Classification E-value
Superfamily Orange domain-like 0.0235
Family Hairy Orange domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_991182.1.45394
Sequence length 155
Comment hairy-related 12 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MAPHSATLASFDHLHFSDKEKIKLRKPIVEKMRRDRINTCIDQLKSLLEKEFHSHDPSTK
LEKADILEMTVSFLKQQIKQQQQIPQRDFNEGYSHCWRESVHFLSLHSNAGELQHLHSGP
KTNSTMGSTPATACSKLNTAALQHPDSVRAVWRPW
Download sequence
Identical sequences Q6TA36
ENSDARP00000044079 ENSDARP00000099379 ENSDARP00000044079 NP_991182.1.45394 7955.ENSDARP00000099379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]