SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_991339.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_991339.1.59421
Domain Number 1 Region: 114-313
Classification Level Classification E-value
Superfamily L domain-like 1.02e-29
Family Ngr ectodomain-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_991339.1.59421
Sequence length 321
Comment opticin precursor [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MKLLALLSLLILMLQEARTASLSEEREGDPYAILHLGDYVLSLDNYDEVIDPSNYDELID
YGDQLPQVKGTSLASLTRTRFTQSTEAARTLPSNPTTARPPTLGLLAAPANHGLPTCLIC
VCLGSSVYCDDADLENIPPLPQTTAYLYARFNRISHIRAGDFKGLTKLKRIDLSGNSISS
IDDKALRLLPALRDLILPENKLVALPTLPTSIEVLDVRMNRLQSSGIQPEAFRALEKLQF
LYLADNLLDAIPPSLPLSLRSLHLQNNMIETMQRDAFCDAEEHRHTRRPLEDIRLDGNPI
NLSLFPSAYFCLPRLPTGRFV
Download sequence
Identical sequences P58874
NP_991339.1.59421 NP_991339.1.76553 XP_005216715.1.76553 ENSBTAP00000018286 ENSBTAP00000018286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]