SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_991388.2.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_991388.2.92730
Domain Number 1 Region: 96-491
Classification Level Classification E-value
Superfamily L domain-like 6.46e-40
Family Internalin LRR domain 0.088
Further Details:      
 
Domain Number 2 Region: 771-925
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.44e-29
Family Toll/Interleukin receptor TIR domain 0.00025
Further Details:      
 
Domain Number 3 Region: 577-700
Classification Level Classification E-value
Superfamily L domain-like 0.00000000384
Family Ngr ectodomain-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_991388.2.92730
Sequence length 931
Comment toll-like receptor 11 [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MLKESMPRMERHQFCSVLLILILLTLVSLTLTGWAWTIPDCIIADSLLFPNLSYYIPFCT
SAPGLHLLASCSNVKNLNQTLKRVPRNTEVLCLQGMVPTLPAKAFIRFHSLQLLRLQLRT
TSVTSRTFQGLDQLQYLFFDHHAPCCLSLFLSPNCFESLRSLSSLSFQGYCLTYSQSIYL
PTSLRHLTLRNSCLTKFQDLQRLFPDLLLSTSSTPNIKPGAPFLETLDLSYNLQLKQAGV
RDLYGLTLHSLILDGTPLKALDLTDSGLLHLHFLSLVGTGIEKVPASLTGYSELRALDLG
KNQIQNILENGEIPGYKALEFLSLHDNHLQTLPTRFLHTLPQLQKLNLSMNKLGPILELP
EGLFSTNLKVLDLSYNQLCDVPHGALSLLSQLQELWLSGNNISSLSNESLQGLRQLRTLD
LSWNQIKVLKPGWLSHLPALTTLNLLGTYLEYILGIQLQGPKMLRHLQLGSYPILDIYPP
WPPTLLSLEIQAESCIQFMIHSGQPFLFLENLTLETSILLLKPDNITIHFPSLRRLTLRG
YSFIFSTSQLQRFFPQQLPLLEHFFIWCENSYAVDLYLFGMPRLRVLELGYLNFFYESST
MKLEMLLKEVPQLQVLALSHLNLRNLSVSSFKSLQDLKLLLFNSERALEMNSNLQEFIPQ
MPQYVYFSDVTFTCQCEASWLESWATRAPNTFVYGLEKSICIANASDYSKTLLFSFLATN
CPHGTEFWGFLTSFILLLLLIILPLISCPKWSWLHHLWTLFHTCWWKLCGHRLRGQFNYD
VFISYCEEDQAWVLEELVPVLEKAPPEGEGLRLCLPARDFGIGNDRMESMIASMGKSRAT
LCVLTGQALASPWCNLELRLATYHLVARPGTTHLLLLFLEPLDRQRLHSYHRLSRWLQKE
DYFDLSQGKVEWNSFCEQLKRRLSKAGQERD
Download sequence
Identical sequences V9GWT0
ENSMUSP00000138814 NP_991388.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]