SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_996262.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_996262.1.87134
Domain Number 1 Region: 174-217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000279
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 2 Region: 213-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000224
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 134-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000839
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 4 Region: 97-130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000028
Family EGF-type module 0.0052
Further Details:      
 
Weak hits

Sequence:  NP_996262.1.87134
Domain Number - Region: 64-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00382
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_996262.1.87134
Sequence length 383
Comment protein delta homolog 2 isoform a precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MPSGCRCLHLVCLLCILGAPGQPVRADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERC
VRMPGCQHGTCHQPWQCICHSGWAGKFCDKDEHICTTQSPCQNGGQCMYDGGGEYHCVCL
PGFHGRDCERKAGPCEQAGSPCRNGGQCQDDQGFALNFTCRCLVGFVGARCEVNVDDCLM
RPCANGATCLDGINRFSCLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPS
GYGGKTCELVLPVPDPPTTVDTPLGPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQEA
GLGEPSLVALVVFGALTAALVLATVLLTLRAWRRGVCPPGPCCYPAPHYAPACQDQECQV
SMLPAGLPLPRDLPPEPGKTTAL
Download sequence
Identical sequences A0A024RD55 Q6UY11
9606.ENSP00000349893 gi|45545431|ref|NP_076421.2| gi|45593147|ref|NP_996262.1| ENSP00000361566 NP_076421.2.87134 NP_076421.2.92137 NP_996262.1.87134 NP_996262.1.92137 ENSP00000349893 ENSP00000361566 ENSP00000349893 ENSP00000361566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]