SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_996944.2.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_996944.2.45394
Domain Number 1 Region: 52-173
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.93e-21
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 
Domain Number 2 Region: 223-273
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000179
Family CUE domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_996944.2.45394
Sequence length 276
Comment toll-interacting protein isoform 1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MATTISTQRGQVYIGELPQDFLRIMPTQQQQQVQLDAQAARQLQYGGSLGTAGRLSITVV
QAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHVTIPENLREGTVVDEWYSLSGRQGDDKEGMINLVMSFATIPAGMM
MQPQPVVLMPTVYQQGVGYVPIAGVPGMYNQGVVPMGMPAAPPVASQSAPCSEEDLKALQ
DMFPNLDKEVIRTVLEAQQGNKDAAINSLLQMAEEL
Download sequence
Identical sequences A0A0R4IZ33
ENSDARP00000112313 7955.ENSDARP00000104220 7955.ENSDARP00000104363 NP_996944.2.45394 ENSDARP00000112313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]