SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_997766.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_997766.1.45394
Domain Number 1 Region: 72-125
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000391
Family Tudor domain 0.0018
Further Details:      
 
Weak hits

Sequence:  NP_997766.1.45394
Domain Number - Region: 8-42
Classification Level Classification E-value
Superfamily TPR-like 0.0974
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_997766.1.45394
Sequence length 237
Comment survival of motor neuron-related-splicing factor 30 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSEELMKQLSNYKAQLQQVEAALSIDPDNEDLLKLQKDLQEVIELTKDLLTSQPAEGTTS
TKSSETVAPSHSWRVGDHCMATWSQDGQVYEAEIEEIDNENGTAAITFAGYGNAEVMPLH
MLKKVEEGRIRDEIDGKPKSKKELQAEQREYKKKKAQKKVQRMKELEQEREDQKSKWQQF
NNKAYSKNKKGQVKRSIFASPESVNGKVGVGTCGIADKPMTQYNDTSKYNVRHLMPQ
Download sequence
Identical sequences B2GRC5 Q7ZV80
7955.ENSDARP00000038215 ENSDARP00000038215 NP_997766.1.45394 ENSDARP00000038215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]