SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_998080.2.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_998080.2.45394
Domain Number 1 Region: 292-550
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.4e-57
Family Extended AAA-ATPase domain 0.0000268
Further Details:      
 
Weak hits

Sequence:  NP_998080.2.45394
Domain Number - Region: 82-142
Classification Level Classification E-value
Superfamily MIT domain 0.000235
Family MIT domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_998080.2.45394
Sequence length 570
Comment spastin [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MNSGHKARLRGGRACGPVSDGSARGNRLLFYTRSLSRVPEWLLRVLLLLLRWLFQPIRRA
MAARAKECGPDGSEETGERIRNYHKQAFEFISVALQIDEDEKGDKQKAVQWYRKGIAELE
KGIQIQVTGAGEKADRARKLQDKMITNLSMAEDRLKLLGNLLSQSPAESSSDDSFYSFSN
GNLRPAPASGAVSKKKDTLTITNQTSLRPKNPPKSTPNASGLNCTPSAAQSSRTGPQNNQ
KGPTVKGKNNVKASTTATASPQRKRDMKNFKNVDSKLASLILNEIVDSGSVVRFDDIAGQ
DLAKQALQEIVILPALRPELFTGLRAPARGLLLFGPPGNGKTMLAKAVAMESNATFFNIS
AATLTSKYVGEGEKLVRALFAVARELQPSIIFIDEIDSLLCERREGEHDASRRLKTEFLI
EFDGVQSGGDERVLVMGATNRPQELDEAVLRRFAKRIYVALPTEETRLKLLKNLLSKHRN
PLSQKELSQLARLTDGYSGSDLTSLAKDAALGPIRELKPEQVRNMSAHEMRDIRISDFLE
SLKRIKRSVSPQTLDQYVRWNREYGDTTGV
Download sequence
Identical sequences Q6NW58
ENSDARP00000029675 ENSDARP00000029675 NP_998080.2.45394 7955.ENSDARP00000029675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]