SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_998116.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_998116.1.45394
Domain Number 1 Region: 207-351
Classification Level Classification E-value
Superfamily PH domain-like 2.71e-40
Family Third domain of FERM 0.00000212
Further Details:      
 
Domain Number 2 Region: 99-206
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-37
Family Second domain of FERM 0.00000194
Further Details:      
 
Domain Number 3 Region: 11-95
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.05e-24
Family First domain of FERM 0.0000157
Further Details:      
 
Domain Number 4 Region: 499-586
Classification Level Classification E-value
Superfamily Moesin tail domain 2.35e-21
Family Moesin tail domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_998116.1.45394
Sequence length 586
Comment neurofibromin 2b (merlin) [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MSILGLKKKQPKTFKVKVSTMDAEMEFSCEVKWKGKDLFDLVCRTIGLRETWFFGLRYTV
KDTYAWLKPDKRVLDQEVPKDSPITFHFLAKFFPEKVEDELVQEITQHLFFLQVKKQILD
EEIFCSPEASVLLASYAVQAKYGDYDPNFHKPGFLAQDELLPKRVLMQYQMTPDMWEEKI
TAWYAEHRNITRDEAEMEYLKIAQDLDMYGVSYFSITQNKRDTELLLGVDAQGLHIYNPN
NKLSPNKSFPWSGIRNISYSEKEFTIKPLDKKKEVFKFYSSQLRVNKLILQLCIGNHDLF
MRRRKVDSIEVQQMKAQAKEEKARKKVERQILAREKQMREEAERAKEEMERRMFQLQDEA
RMANEALLRSEETADLLAEKAQIAEEEAKLLAHKAAEAEQERQRLEVTALKTKEEKRLME
QKMREAEQLAVKLVEQSERRLKEADHLKQDLNEAKDAERRAKQKLLEITKTTYPLIAAYS
NPPPPAGPESPEMAIEMGNPIQMDFKDSDMKRLSMEIERERLEYMEKSKHLQDQLKELKS
EIESLKLEEQQQAGVYNLRSYAEPPFIPPSNRNSAYMAQMAFYEEV
Download sequence
Identical sequences Q6Q413
7955.ENSDARP00000035057 ENSDARP00000035057 ENSDARP00000112172 ENSDARP00000035057 NP_998116.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]