SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000025329.1.68346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000025329.1.68346
Domain Number 1 Region: 18-133
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000131
Family SMI1/KNR4-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000025329.1.68346
Sequence length 142
Comment MULTISPECIES: SMI1/KNR4 family protein [Bacillus cereus group]; AA=GCF_001880115.1; RF=na; TAX=1433; STAX=1428; NAME=Bacillus thuringiensis serovar aizawai; strain=HD-133; AL=Scaffold; RT=Major
Sequence
MSILENLNAVFTLETQEPPATKETIQELQGFSSIDVPSDYLEIIQHCTDAEINVNNEIYI
RIWSPADCIEMNEAHNIQKYIPNSLAIGDDEGGKVLLYANGKEGFGLYMVDFGDLDIEEA
IKISPSLKLLLMDGVGVEKLLL
Download sequence
Identical sequences A0A0F6FHY8 A0A0F6IWD7 A0A0G4DA46 A0A243G732 A0A2A8KJL7 M1PWK5 R8LTB9 R8PV52
gi|452195967|ref|YP_007482465.1| gi|384183893|ref|YP_005569526.1| WP_000025329.1.10688 WP_000025329.1.1112 WP_000025329.1.18749 WP_000025329.1.23181 WP_000025329.1.29836 WP_000025329.1.33790 WP_000025329.1.34175 WP_000025329.1.34587 WP_000025329.1.37239 WP_000025329.1.38427 WP_000025329.1.38591 WP_000025329.1.4185 WP_000025329.1.41879 WP_000025329.1.42167 WP_000025329.1.42218 WP_000025329.1.43767 WP_000025329.1.43914 WP_000025329.1.44497 WP_000025329.1.46586 WP_000025329.1.49702 WP_000025329.1.50694 WP_000025329.1.51047 WP_000025329.1.54777 WP_000025329.1.57561 WP_000025329.1.58632 WP_000025329.1.64764 WP_000025329.1.64770 WP_000025329.1.674 WP_000025329.1.6743 WP_000025329.1.68007 WP_000025329.1.68346 WP_000025329.1.69501 WP_000025329.1.70181 WP_000025329.1.74372 WP_000025329.1.74832 WP_000025329.1.74857 WP_000025329.1.74976 WP_000025329.1.77386 WP_000025329.1.80622 WP_000025329.1.83694 WP_000025329.1.83977 WP_000025329.1.84541 WP_000025329.1.85928 WP_000025329.1.87013 WP_000025329.1.87725 WP_000025329.1.89718 WP_000025329.1.90665 WP_000025329.1.93683 WP_000025329.1.9860 gi|384183893|ref|YP_005569526.1|NC_017203 gi|452195967|ref|YP_007482465.1|NC_020384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]