SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000043857.1.17815 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000043857.1.17815
Domain Number 1 Region: 9-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 7.59e-45
Family Ribonuclease PH domain 1-like 0.0000328
Further Details:      
 
Domain Number 2 Region: 297-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.1e-42
Family Ribonuclease PH domain 1-like 0.00000976
Further Details:      
 
Domain Number 3 Region: 143-233
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.5e-28
Family Ribonuclease PH domain 2-like 0.002
Further Details:      
 
Domain Number 4 Region: 453-550
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 7.46e-28
Family Ribonuclease PH domain 2-like 0.0000813
Further Details:      
 
Domain Number 5 Region: 613-697
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.83e-20
Family Cold shock DNA-binding domain-like 0.00095
Further Details:      
 
Domain Number 6 Region: 555-632
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000137
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 7 Region: 236-323
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000549
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000043857.1.17815
Sequence length 709
Comment MULTISPECIES: polyribonucleotide nucleotidyltransferase [Streptococcus]; AA=GCF_000290135.1; RF=na; TAX=1154905; STAX=1311; NAME=Streptococcus agalactiae GB00190; strain=GB00190; AL=Contig; RT=Major
Sequence
MSKQVFEMIFAGKKLVVETGQVAKQANGSVVVRYGDSTVLTAAVMSKKMSTGDFFPLQVN
YEEKMYAAGKFPGGFNKREGRPSTDATLTARLIDRPIRPMFAEGFRNEVQVINTVLSFDE
NASAPMAAMFGSSLALSISDIPFNGPIAGVQVAYVDGNFIINPTAQEQEASALELTVAGT
KEAINMVESGAKELSEEIMLEALLKGHEAVCELIAFQEEIVTAIGKEKAEVELLQVDPEL
QAEIIATHNIALQAAVQVEEKKAREAATEAVKEVVIGEYEARYAEHEEYDRIMRDVAEIL
EQMEHAEVRRLITEDKVRPDGRRVDEIRPLDAVIDFLPQVHGSGLFTRGQTQALSVLTLA
PMGEAQIIDGLTPEYKKRFMHHYNFPQYSVGETGRYGAAGRREIGHGALGERALEQVLPS
LEEFPYAIRLVAEVLESNGSSSQASICAGTLALMAGGVPIKAPVAGIAMGLISDGTNYTV
LTDIQGLEDHFGDMDFKVAGTREGITALQMDIKIEGITPQILEEALAQAKKARFEILDVL
HGAIAEPRPQLAPTAPKIDMIKIDVDKIKVVIGKGGETIDKIIAETGVKIDIDEEGNVSI
FSSDQAAIDRTKDIIASLVREAKVGEVYHAKVVRIEKFGAFVNLFDKTDALVHISEIAWT
RTANVADVLEIGEEVDVKVIKIDDKGRVDASMKALLPRPPKADNPKKES
Download sequence
Identical sequences Q8E7F6
gi|25010273|ref|NP_734668.1| WP_000043857.1.100093 WP_000043857.1.100267 WP_000043857.1.100296 WP_000043857.1.100520 WP_000043857.1.100913 WP_000043857.1.101319 WP_000043857.1.10645 WP_000043857.1.1163 WP_000043857.1.12102 WP_000043857.1.13658 WP_000043857.1.15199 WP_000043857.1.15760 WP_000043857.1.16528 WP_000043857.1.1681 WP_000043857.1.1696 WP_000043857.1.17056 WP_000043857.1.17707 WP_000043857.1.17815 WP_000043857.1.20435 WP_000043857.1.23126 WP_000043857.1.24162 WP_000043857.1.25182 WP_000043857.1.25647 WP_000043857.1.25949 WP_000043857.1.26046 WP_000043857.1.26786 WP_000043857.1.27318 WP_000043857.1.28630 WP_000043857.1.29771 WP_000043857.1.3028 WP_000043857.1.30321 WP_000043857.1.30388 WP_000043857.1.31250 WP_000043857.1.31894 WP_000043857.1.31904 WP_000043857.1.32053 WP_000043857.1.33105 WP_000043857.1.3543 WP_000043857.1.35451 WP_000043857.1.36594 WP_000043857.1.36710 WP_000043857.1.37547 WP_000043857.1.39284 WP_000043857.1.39656 WP_000043857.1.39673 WP_000043857.1.40650 WP_000043857.1.40774 WP_000043857.1.41329 WP_000043857.1.43138 WP_000043857.1.44777 WP_000043857.1.45782 WP_000043857.1.46043 WP_000043857.1.46747 WP_000043857.1.47497 WP_000043857.1.47584 WP_000043857.1.48416 WP_000043857.1.48502 WP_000043857.1.48518 WP_000043857.1.48557 WP_000043857.1.49371 WP_000043857.1.50186 WP_000043857.1.50552 WP_000043857.1.50776 WP_000043857.1.53549 WP_000043857.1.54156 WP_000043857.1.54487 WP_000043857.1.54757 WP_000043857.1.54844 WP_000043857.1.54896 WP_000043857.1.54978 WP_000043857.1.55775 WP_000043857.1.55921 WP_000043857.1.56011 WP_000043857.1.56192 WP_000043857.1.57336 WP_000043857.1.57756 WP_000043857.1.58255 WP_000043857.1.58297 WP_000043857.1.58520 WP_000043857.1.58988 WP_000043857.1.59783 WP_000043857.1.60290 WP_000043857.1.61176 WP_000043857.1.6131 WP_000043857.1.62276 WP_000043857.1.63345 WP_000043857.1.63508 WP_000043857.1.64256 WP_000043857.1.65036 WP_000043857.1.6512 WP_000043857.1.67002 WP_000043857.1.67277 WP_000043857.1.68641 WP_000043857.1.68905 WP_000043857.1.69214 WP_000043857.1.7017 WP_000043857.1.70242 WP_000043857.1.70879 WP_000043857.1.70897 WP_000043857.1.72284 WP_000043857.1.73625 WP_000043857.1.74375 WP_000043857.1.74564 WP_000043857.1.74739 WP_000043857.1.7530 WP_000043857.1.75801 WP_000043857.1.76222 WP_000043857.1.76334 WP_000043857.1.76479 WP_000043857.1.76747 WP_000043857.1.77493 WP_000043857.1.78552 WP_000043857.1.78994 WP_000043857.1.80046 WP_000043857.1.80895 WP_000043857.1.83429 WP_000043857.1.83723 WP_000043857.1.84909 WP_000043857.1.85015 WP_000043857.1.8568 WP_000043857.1.86400 WP_000043857.1.86511 WP_000043857.1.87062 WP_000043857.1.87546 WP_000043857.1.87697 WP_000043857.1.87810 WP_000043857.1.88248 WP_000043857.1.90136 WP_000043857.1.9125 WP_000043857.1.92811 WP_000043857.1.93358 WP_000043857.1.93607 WP_000043857.1.94310 WP_000043857.1.95993 WP_000043857.1.96026 WP_000043857.1.96475 WP_000043857.1.99149 211110.gbs0198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]