SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000049736.1.41165 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000049736.1.41165
Domain Number 1 Region: 23-334
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.88e-113
Family Glycosyl hydrolases family 32 N-terminal domain 0.00000382
Further Details:      
 
Domain Number 2 Region: 333-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.6e-26
Family Glycosyl hydrolases family 32 C-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000049736.1.41165
Sequence length 491
Comment beta-fructofuranosidase [Bacillus anthracis]; AA=GCF_000986915.1; RF=na; TAX=1392; STAX=1392; NAME=Bacillus anthracis; strain=A1039; AL=Contig; RT=Major
Sequence
MSKYKTILQSNKDELHSLYEIANQDSWKPIYHIHPPFGLMNDPNGVSYYNDEYHVFYQWY
PFGPIHGMKHWGHVKSKDLINWERMPVAIIPTESYESHGAYSGSAIVKDDLLHLLYTGNI
KNPDDSRDAKQCMATMDSQYTMTKYSNNPVIDIIPDGYTKHVRDPKVWKHNDIYYMLLGA
QRKNKTGTLLLYKSKDLYNWNFQGEITTNLKEFGFMWECPDYFQLSGKDVLLFSPQGIEK
DREDFHNIYNVVYAIGHFDIKNLYFHIDSYYEADKGFDFYAPQTLEDSTSRRLLFAWAGS
SEITYPSDDYMWAHCLTLPRELTLEDNILKQKPVSELTKLRTTKKEISGDITAGLNVLST
LDNEGSYELIVTLKTEDAKRFGLSLFHNEEECFPITFNREQGTISIDRGNFYHQFGGEYG
FERCKKIDIQDTIELQIFVDKSIVEIFLYDGSTVFTSRVFPRKDMKHHIAIFSDAKLNFT
ITQYKLKRGIV
Download sequence
Identical sequences A0A0F7RMZ7 Q81UV4
gi|30260900|ref|NP_843277.1| NP_843277.1.87267 WP_000049736.1.100214 WP_000049736.1.100595 WP_000049736.1.10208 WP_000049736.1.11427 WP_000049736.1.11676 WP_000049736.1.13115 WP_000049736.1.13233 WP_000049736.1.13820 WP_000049736.1.14721 WP_000049736.1.14855 WP_000049736.1.15460 WP_000049736.1.15569 WP_000049736.1.16170 WP_000049736.1.16997 WP_000049736.1.17146 WP_000049736.1.18976 WP_000049736.1.19258 WP_000049736.1.19435 WP_000049736.1.19445 WP_000049736.1.20390 WP_000049736.1.20680 WP_000049736.1.21021 WP_000049736.1.21258 WP_000049736.1.21776 WP_000049736.1.22865 WP_000049736.1.23269 WP_000049736.1.2419 WP_000049736.1.24334 WP_000049736.1.24556 WP_000049736.1.24608 WP_000049736.1.25716 WP_000049736.1.25752 WP_000049736.1.2618 WP_000049736.1.26665 WP_000049736.1.26721 WP_000049736.1.27644 WP_000049736.1.27987 WP_000049736.1.28427 WP_000049736.1.28729 WP_000049736.1.29101 WP_000049736.1.29787 WP_000049736.1.30110 WP_000049736.1.31490 WP_000049736.1.3236 WP_000049736.1.32576 WP_000049736.1.33175 WP_000049736.1.33338 WP_000049736.1.33367 WP_000049736.1.33740 WP_000049736.1.33876 WP_000049736.1.34646 WP_000049736.1.35684 WP_000049736.1.35886 WP_000049736.1.36763 WP_000049736.1.38036 WP_000049736.1.39781 WP_000049736.1.40550 WP_000049736.1.41165 WP_000049736.1.41675 WP_000049736.1.4439 WP_000049736.1.45305 WP_000049736.1.45533 WP_000049736.1.46236 WP_000049736.1.46699 WP_000049736.1.47145 WP_000049736.1.4763 WP_000049736.1.47644 WP_000049736.1.47798 WP_000049736.1.51749 WP_000049736.1.52794 WP_000049736.1.53137 WP_000049736.1.53493 WP_000049736.1.53683 WP_000049736.1.54117 WP_000049736.1.54189 WP_000049736.1.55811 WP_000049736.1.55958 WP_000049736.1.56042 WP_000049736.1.56176 WP_000049736.1.56270 WP_000049736.1.56959 WP_000049736.1.58160 WP_000049736.1.59095 WP_000049736.1.59575 WP_000049736.1.60402 WP_000049736.1.61213 WP_000049736.1.63560 WP_000049736.1.68607 WP_000049736.1.69203 WP_000049736.1.69822 WP_000049736.1.69894 WP_000049736.1.70065 WP_000049736.1.70996 WP_000049736.1.72704 WP_000049736.1.73325 WP_000049736.1.74226 WP_000049736.1.74538 WP_000049736.1.75499 WP_000049736.1.75870 WP_000049736.1.76125 WP_000049736.1.76783 WP_000049736.1.77668 WP_000049736.1.77824 WP_000049736.1.78644 WP_000049736.1.79315 WP_000049736.1.79584 WP_000049736.1.80439 WP_000049736.1.80695 WP_000049736.1.81799 WP_000049736.1.82289 WP_000049736.1.83951 WP_000049736.1.84045 WP_000049736.1.85689 WP_000049736.1.86119 WP_000049736.1.86140 WP_000049736.1.86239 WP_000049736.1.86288 WP_000049736.1.8698 WP_000049736.1.8825 WP_000049736.1.88641 WP_000049736.1.90791 WP_000049736.1.90883 WP_000049736.1.9186 WP_000049736.1.93271 WP_000049736.1.93744 WP_000049736.1.93927 WP_000049736.1.94237 WP_000049736.1.94322 WP_000049736.1.94784 WP_000049736.1.96934 WP_000049736.1.97781 WP_000049736.1.97861 WP_000049736.1.98216 WP_000049736.1.99445 WP_000049736.1.99485 WP_000049736.1.99994 YP_026993.1.16718 gi|386734592|ref|YP_006207773.1| gi|227816376|ref|YP_002816385.1| gi|229601106|ref|YP_002865343.1| gi|47526036|ref|YP_017385.1| gi|49183741|ref|YP_026993.1| 198094.BA_0753 260799.BAS0717 261594.GBAA0753 568206.BAMEG_3805 592021.BAA_0861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]