SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000062341.1.33790 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000062341.1.33790
Domain Number - Region: 6-65
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0126
Family Regulator of G-protein signaling, RGS 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000062341.1.33790
Sequence length 109
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_000571955.1; RF=na; TAX=1306023; STAX=1428; NAME=Bacillus thuringiensis serovar tolworthi NA205-3; strain=NA205-3; AL=Contig; RT=Major
Sequence
MSMNHSDFFDLLQSKEVLLNNQELRQSFESIINGFIANEMPDLENIPLEHIDEFEKQFEQ
LRHYVTFYSGNSFRINGPDCELKEMLHLHLFTEQLEDVEKQGLEDEIFI
Download sequence
Identical sequences A0A0F6FIH2 A0A0F6IXW8 A0A0G4DAE1 A0A243GZE9 A0A2A8KFX9 M1QKP8 R8MBM9 R8PAQ6
gi|384183970|ref|YP_005569603.1|NC_017203 gi|452196046|ref|YP_007482544.1|NC_020384 gi|384183970|ref|YP_005569603.1| WP_000062341.1.10688 WP_000062341.1.1112 WP_000062341.1.18749 WP_000062341.1.23181 WP_000062341.1.29836 WP_000062341.1.33790 WP_000062341.1.34175 WP_000062341.1.34587 WP_000062341.1.37239 WP_000062341.1.38427 WP_000062341.1.38591 WP_000062341.1.4185 WP_000062341.1.41879 WP_000062341.1.42167 WP_000062341.1.42218 WP_000062341.1.43767 WP_000062341.1.43914 WP_000062341.1.44497 WP_000062341.1.49455 WP_000062341.1.49702 WP_000062341.1.50694 WP_000062341.1.51047 WP_000062341.1.54777 WP_000062341.1.57561 WP_000062341.1.58632 WP_000062341.1.64764 WP_000062341.1.674 WP_000062341.1.6743 WP_000062341.1.68007 WP_000062341.1.68346 WP_000062341.1.69501 WP_000062341.1.70181 WP_000062341.1.74372 WP_000062341.1.74832 WP_000062341.1.74857 WP_000062341.1.74976 WP_000062341.1.77386 WP_000062341.1.80622 WP_000062341.1.83694 WP_000062341.1.83977 WP_000062341.1.84541 WP_000062341.1.87013 WP_000062341.1.87725 WP_000062341.1.89009 WP_000062341.1.89718 WP_000062341.1.90665 WP_000062341.1.93683 WP_000062341.1.9860 gi|452196046|ref|YP_007482544.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]