SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000149893.1.28517 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000149893.1.28517
Domain Number 1 Region: 293-487
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.4e-46
Family Ribonuclease PH domain 1-like 0.0000228
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-42
Family Ribonuclease PH domain 1-like 0.0000762
Further Details:      
 
Domain Number 3 Region: 136-226
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.31e-26
Family Ribonuclease PH domain 2-like 0.0018
Further Details:      
 
Domain Number 4 Region: 449-545
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.65e-23
Family Ribonuclease PH domain 2-like 0.00019
Further Details:      
 
Domain Number 5 Region: 608-694
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.8e-22
Family Cold shock DNA-binding domain-like 0.0005
Further Details:      
 
Domain Number 6 Region: 225-324
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 2.35e-20
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0044
Further Details:      
 
Domain Number 7 Region: 552-629
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000194
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000149893.1.28517
Sequence length 698
Comment polyribonucleotide nucleotidyltransferase [Leptospira interrogans]; AA=GCF_001567705.1; RF=na; TAX=173; STAX=173; NAME=Leptospira interrogans; strain=56678; AL=Contig; RT=Major
Sequence
MTHTISGQYGRDTIVLETGSWAKQAHGAVVYKSGNLVLLATVCAADEAKEGQDFFPLTCE
YTEKLYSVGRFPGGYFKREAKPPEHEILISRIIDRPIRPLFPEGYFCEVQLQVQVLSADG
DVSVAGHALNAASAALAVSDIPFNGPIAGARIGRVNGELILNPTTKEILNSDLDLVVAGT
KTHIVMIEGEAKELSNEEMIAALRFAQKHIAEFVTLQEEYAKKIGVVKREVKLKVRDEEL
LSKVKEYAFAKLTTANQTPDKTARNKEISNVNKEVVEFFKDTIEDSDKIKDIKAYLHELE
YEIVREQVLTKGTRFDGRKLDEIRSISVEINPLPGPHGSAVFTRGQTQSLGVVTLGTGSD
NQRYETLEGQKEKSFMLHYNFPAFSVGEVRRSSGPGRREIGHGNLAERALKLVLPKPDEF
PYVIRVVSEILESNGSSSMASVCSGSLALMAAGVPIQGSVSGIAMGLFSDSSGKYAVLSD
IAGLEDHFGDMDCKIAGTRKGITAFQMDLKVTGVSFDVLESVFEQAQRGRFHILDIMEKH
ISKASSTLAGTAPRIIVRNIPKDRIGELIGPGGKNVRGISELTGAELYIEDDGKVTISGS
NQESAEKAAKMVDGFFAEVEVGKIYEGKVKRIADFGAFVEILPGKEGLCHISKIDFKRVN
SVKDIVKEGDIIRVKVLNVDKTGKIDLSRKDALEEEQV
Download sequence
Identical sequences A0A1N6V5L3 A0A1X8WIF3 A0A2H1XEF4 M3E8U0 M6KCK5 Q72NX7 Q8F7J8
gi|45658536|ref|YP_002622.1| gi|24213647|ref|NP_711128.1| 189518.LA0947 267671.LIC12701 gi|386073244|ref|YP_005987561.1| NP_711128.1.97817 WP_000149893.1.10054 WP_000149893.1.100607 WP_000149893.1.100943 WP_000149893.1.101113 WP_000149893.1.101360 WP_000149893.1.11367 WP_000149893.1.12257 WP_000149893.1.12296 WP_000149893.1.13846 WP_000149893.1.14057 WP_000149893.1.14552 WP_000149893.1.15739 WP_000149893.1.17129 WP_000149893.1.17260 WP_000149893.1.1759 WP_000149893.1.17762 WP_000149893.1.18168 WP_000149893.1.19636 WP_000149893.1.19821 WP_000149893.1.20233 WP_000149893.1.2069 WP_000149893.1.22564 WP_000149893.1.22580 WP_000149893.1.23212 WP_000149893.1.23353 WP_000149893.1.2392 WP_000149893.1.250 WP_000149893.1.25470 WP_000149893.1.25773 WP_000149893.1.26235 WP_000149893.1.26477 WP_000149893.1.28 WP_000149893.1.28517 WP_000149893.1.2987 WP_000149893.1.30921 WP_000149893.1.30957 WP_000149893.1.31178 WP_000149893.1.3128 WP_000149893.1.32453 WP_000149893.1.32692 WP_000149893.1.32859 WP_000149893.1.3288 WP_000149893.1.33670 WP_000149893.1.339 WP_000149893.1.34457 WP_000149893.1.35515 WP_000149893.1.35633 WP_000149893.1.36128 WP_000149893.1.36297 WP_000149893.1.3754 WP_000149893.1.37594 WP_000149893.1.38403 WP_000149893.1.39007 WP_000149893.1.39787 WP_000149893.1.39967 WP_000149893.1.40783 WP_000149893.1.41353 WP_000149893.1.41637 WP_000149893.1.42222 WP_000149893.1.43311 WP_000149893.1.43353 WP_000149893.1.43570 WP_000149893.1.4572 WP_000149893.1.46812 WP_000149893.1.46987 WP_000149893.1.47834 WP_000149893.1.48092 WP_000149893.1.48108 WP_000149893.1.48207 WP_000149893.1.49352 WP_000149893.1.50403 WP_000149893.1.50455 WP_000149893.1.50786 WP_000149893.1.50904 WP_000149893.1.5165 WP_000149893.1.52351 WP_000149893.1.53255 WP_000149893.1.55693 WP_000149893.1.55703 WP_000149893.1.56120 WP_000149893.1.58511 WP_000149893.1.6135 WP_000149893.1.61658 WP_000149893.1.63084 WP_000149893.1.63541 WP_000149893.1.63646 WP_000149893.1.64760 WP_000149893.1.65294 WP_000149893.1.65513 WP_000149893.1.65559 WP_000149893.1.6574 WP_000149893.1.668 WP_000149893.1.67052 WP_000149893.1.67344 WP_000149893.1.6761 WP_000149893.1.68135 WP_000149893.1.68426 WP_000149893.1.70516 WP_000149893.1.70921 WP_000149893.1.72166 WP_000149893.1.72187 WP_000149893.1.7280 WP_000149893.1.72830 WP_000149893.1.73302 WP_000149893.1.74515 WP_000149893.1.74558 WP_000149893.1.75054 WP_000149893.1.75377 WP_000149893.1.76404 WP_000149893.1.76740 WP_000149893.1.76970 WP_000149893.1.76971 WP_000149893.1.77242 WP_000149893.1.77874 WP_000149893.1.78069 WP_000149893.1.7821 WP_000149893.1.78364 WP_000149893.1.78551 WP_000149893.1.79237 WP_000149893.1.81803 WP_000149893.1.82080 WP_000149893.1.82375 WP_000149893.1.82393 WP_000149893.1.83052 WP_000149893.1.83201 WP_000149893.1.84222 WP_000149893.1.84406 WP_000149893.1.84450 WP_000149893.1.86863 WP_000149893.1.86894 WP_000149893.1.87123 WP_000149893.1.8721 WP_000149893.1.8748 WP_000149893.1.87797 WP_000149893.1.88006 WP_000149893.1.88844 WP_000149893.1.8916 WP_000149893.1.89725 WP_000149893.1.90537 WP_000149893.1.90631 WP_000149893.1.90803 WP_000149893.1.91013 WP_000149893.1.91017 WP_000149893.1.91046 WP_000149893.1.91324 WP_000149893.1.92480 WP_000149893.1.9249 WP_000149893.1.95586 WP_000149893.1.95836 WP_000149893.1.9683 WP_000149893.1.96841 WP_000149893.1.97198 WP_000149893.1.97216 WP_000149893.1.97385 WP_000149893.1.97703 WP_000149893.1.98154 WP_000149893.1.9886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]