SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000164881.1.20687 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000164881.1.20687
Domain Number - Region: 437-466
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0222
Family Pseudo ankyrin repeat 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000164881.1.20687
Sequence length 488
Comment hypothetical protein [Bacillus cereus]; AA=GCF_002199845.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=MOD1_Bc186; AL=Scaffold; RT=Major
Sequence
MTKNNEAGWNLDHSYTTLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEI
AIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQMTPAGKRFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEDHENRYTALLQEVIKRQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWD
LARLAESLIPILHEDEEEALKIAQDEISKFSVQYENQWFLGMKKKLGLFSNEEQDQSLIE
QLLKMMEKFKADYTNTFRSLTLNTLENTPLFDSPEFKEWYKLWQSRLEKQDESKENAYEM
MKNNNPSIIPRNHRVEEALEAAVTSGDYSVMEKLLEALANPYAYTTDQEEYCVPPAPTNR
PYRTFCGT
Download sequence
Identical sequences A0A1Y6AQD5 A0A229MM04 B7HZ82 B9ITN8 C2S6I2
361100.BCQ_3304 405534.BCAH187_A3529 gi|217960907|ref|YP_002339473.1| gi|375285410|ref|YP_005105849.1| WP_000164881.1.10762 WP_000164881.1.12751 WP_000164881.1.13024 WP_000164881.1.13299 WP_000164881.1.17408 WP_000164881.1.18840 WP_000164881.1.20687 WP_000164881.1.24184 WP_000164881.1.24377 WP_000164881.1.26499 WP_000164881.1.27334 WP_000164881.1.29209 WP_000164881.1.31685 WP_000164881.1.32522 WP_000164881.1.33045 WP_000164881.1.33061 WP_000164881.1.3318 WP_000164881.1.3615 WP_000164881.1.37093 WP_000164881.1.37990 WP_000164881.1.43762 WP_000164881.1.44463 WP_000164881.1.46746 WP_000164881.1.47097 WP_000164881.1.48164 WP_000164881.1.48311 WP_000164881.1.48599 WP_000164881.1.49428 WP_000164881.1.50316 WP_000164881.1.50514 WP_000164881.1.51087 WP_000164881.1.52756 WP_000164881.1.54775 WP_000164881.1.54782 WP_000164881.1.55057 WP_000164881.1.56055 WP_000164881.1.57203 WP_000164881.1.57815 WP_000164881.1.57859 WP_000164881.1.58814 WP_000164881.1.59773 WP_000164881.1.60274 WP_000164881.1.64377 WP_000164881.1.70645 WP_000164881.1.72514 WP_000164881.1.77576 WP_000164881.1.77690 WP_000164881.1.79658 WP_000164881.1.81088 WP_000164881.1.82533 WP_000164881.1.82986 WP_000164881.1.84337 WP_000164881.1.8923 WP_000164881.1.91404 WP_000164881.1.91615 WP_000164881.1.93932 WP_000164881.1.95457 WP_000164881.1.95484 WP_000164881.1.99266 gi|222096964|ref|YP_002531021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]