SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000164937.1.100409 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000164937.1.100409
Domain Number - Region: 437-464
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0157
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000164937.1.100409
Sequence length 488
Comment SELO family protein [Bacillus thuringiensis]; AA=GCF_002146905.1; RF=na; TAX=180867; STAX=1428; NAME=Bacillus thuringiensis serovar vazensis; strain=BGSC 4CE1; AL=Contig; RT=Major
Sequence
MTKNNEVGWNLDNSYATLPQSFYTEIPPTPVSSPELVKLNHSLAISLGFNPEELKKEAEI
AIFAGNALPEGAHPLAQAYAGHQFGHFNMLGDGRALLIGEQITPSGKRFDIQLKGSGPTP
YSRRGDGRAALGPMLREYIISEAMYALDIPTTRSLAVVTTGEPTYRETKLPGAILTRVAS
SHIRVGTFQYAAARGSIEDLQSLADYTIKRHYPEIEAHENRYTALLQEVIKKQASLIAKW
QLVGFIHGVMNTDNITISGETIDYGPCAFMDNYDQGTVFSSIDTQGRYAYGNQPYMAAWD
LARLAESLIPILHEDEEEALKIAQDEISKFSVQYENQWFLGMKRKLGLFSNDEQDQSLIE
QLLKMMEKFKADYTNTFRSLTLNTIENTALFESPEFKEWYKLWQSRLERQEESKENAYEM
MKNNNPSIIPRNHRVEEALEAAVANGDYSVMEKLLEALANPYAYSTDQEEYCVPPAPTNR
PYRTFCGT
Download sequence
Identical sequences A0A243CYB4
WP_000164937.1.100409 WP_000164937.1.63611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]