SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000196703.1.16873 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000196703.1.16873
Domain Number 1 Region: 3-131
Classification Level Classification E-value
Superfamily Phage tail protein-like 1.15e-47
Family Lambda phage gpU-like 0.00000802
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000196703.1.16873
Sequence length 133
Comment tail protein [Salmonella enterica]; AA=GCF_001952285.1; RF=na; TAX=28901; STAX=28901; NAME=Salmonella enterica; strain=CVM N23600; AL=Scaffold; RT=Major
Sequence
MTRHSAVRQAIIAALKKTDDGSTTFFDGRPVVVEEDELPAVAVYLSDAQYTGTEVDGDIW
SAVLHVEVFLKATAPDSALDEQMENRVYPALGSVAGLGDIIRTMSAQGYNYQRDDEMAMW
GSADLSYDITYSM
Download sequence
Identical sequences A0A0G2NMT8 A0A249V036 A0A265B8Q3 A0A2D3GFR4 A0A2G1NNV5 B5R8R1 C0PVU6 M7RVE9
gi|205352455|ref|YP_002226256.1| ABEL01000010|CDS_56300-56701 ABFF01000016|CDS_37387-36986 AM933173|CDS_1292106-1292507 CP000857|CDS_2751023-2750622 CP001120|CDS_1128915-1129316 CP001144|CDS_1380576-1380977 gi|525816927|ref|YP_008246945.1| gi|525827089|ref|YP_008249618.1| gi|194447954|ref|YP_002045041.1| gi|224584456|ref|YP_002638254.1| gi|386590908|ref|YP_006087308.1| WP_000196703.1.100017 WP_000196703.1.100541 WP_000196703.1.100730 WP_000196703.1.101042 WP_000196703.1.101126 WP_000196703.1.1013 WP_000196703.1.101454 WP_000196703.1.101636 WP_000196703.1.101927 WP_000196703.1.101975 WP_000196703.1.10231 WP_000196703.1.10566 WP_000196703.1.10711 WP_000196703.1.1110 WP_000196703.1.11156 WP_000196703.1.11588 WP_000196703.1.11677 WP_000196703.1.11687 WP_000196703.1.11735 WP_000196703.1.11834 WP_000196703.1.11964 WP_000196703.1.12017 WP_000196703.1.12280 WP_000196703.1.1239 WP_000196703.1.12701 WP_000196703.1.13207 WP_000196703.1.13661 WP_000196703.1.14050 WP_000196703.1.14056 WP_000196703.1.14111 WP_000196703.1.14436 WP_000196703.1.14458 WP_000196703.1.14618 WP_000196703.1.14876 WP_000196703.1.15214 WP_000196703.1.15627 WP_000196703.1.15637 WP_000196703.1.15862 WP_000196703.1.15910 WP_000196703.1.15986 WP_000196703.1.16004 WP_000196703.1.16047 WP_000196703.1.16244 WP_000196703.1.16361 WP_000196703.1.16525 WP_000196703.1.16551 WP_000196703.1.16873 WP_000196703.1.1689 WP_000196703.1.16903 WP_000196703.1.17093 WP_000196703.1.1757 WP_000196703.1.17743 WP_000196703.1.17755 WP_000196703.1.17891 WP_000196703.1.1798 WP_000196703.1.18122 WP_000196703.1.1818 WP_000196703.1.1825 WP_000196703.1.18254 WP_000196703.1.18281 WP_000196703.1.19273 WP_000196703.1.19588 WP_000196703.1.19616 WP_000196703.1.19642 WP_000196703.1.1968 WP_000196703.1.19740 WP_000196703.1.19793 WP_000196703.1.19938 WP_000196703.1.19975 WP_000196703.1.20415 WP_000196703.1.20446 WP_000196703.1.2047 WP_000196703.1.20488 WP_000196703.1.20614 WP_000196703.1.20767 WP_000196703.1.20862 WP_000196703.1.20900 WP_000196703.1.21136 WP_000196703.1.21351 WP_000196703.1.2146 WP_000196703.1.21616 WP_000196703.1.21991 WP_000196703.1.22235 WP_000196703.1.22590 WP_000196703.1.22692 WP_000196703.1.22758 WP_000196703.1.22864 WP_000196703.1.23379 WP_000196703.1.23509 WP_000196703.1.23646 WP_000196703.1.23959 WP_000196703.1.24082 WP_000196703.1.24803 WP_000196703.1.24995 WP_000196703.1.25119 WP_000196703.1.25421 WP_000196703.1.25564 WP_000196703.1.2568 WP_000196703.1.25709 WP_000196703.1.25928 WP_000196703.1.26199 WP_000196703.1.26532 WP_000196703.1.26587 WP_000196703.1.26741 WP_000196703.1.26856 WP_000196703.1.26882 WP_000196703.1.26919 WP_000196703.1.27072 WP_000196703.1.27084 WP_000196703.1.27223 WP_000196703.1.27544 WP_000196703.1.27755 WP_000196703.1.28032 WP_000196703.1.28512 WP_000196703.1.28514 WP_000196703.1.28733 WP_000196703.1.28948 WP_000196703.1.29113 WP_000196703.1.29274 WP_000196703.1.29349 WP_000196703.1.29509 WP_000196703.1.29827 WP_000196703.1.29990 WP_000196703.1.30022 WP_000196703.1.30202 WP_000196703.1.30619 WP_000196703.1.3067 WP_000196703.1.3068 WP_000196703.1.31092 WP_000196703.1.31122 WP_000196703.1.3114 WP_000196703.1.31451 WP_000196703.1.31665 WP_000196703.1.31983 WP_000196703.1.32255 WP_000196703.1.32260 WP_000196703.1.32491 WP_000196703.1.32527 WP_000196703.1.33106 WP_000196703.1.33580 WP_000196703.1.33865 WP_000196703.1.3394 WP_000196703.1.33986 WP_000196703.1.34417 WP_000196703.1.34458 WP_000196703.1.34684 WP_000196703.1.34854 WP_000196703.1.34972 WP_000196703.1.35193 WP_000196703.1.35332 WP_000196703.1.35619 WP_000196703.1.35892 WP_000196703.1.36011 WP_000196703.1.36017 WP_000196703.1.3726 WP_000196703.1.37478 WP_000196703.1.37521 WP_000196703.1.38393 WP_000196703.1.38569 WP_000196703.1.38781 WP_000196703.1.39265 WP_000196703.1.39414 WP_000196703.1.39584 WP_000196703.1.39609 WP_000196703.1.39614 WP_000196703.1.39632 WP_000196703.1.39724 WP_000196703.1.40158 WP_000196703.1.40229 WP_000196703.1.40258 WP_000196703.1.40284 WP_000196703.1.40341 WP_000196703.1.40528 WP_000196703.1.40996 WP_000196703.1.41018 WP_000196703.1.4141 WP_000196703.1.41434 WP_000196703.1.41440 WP_000196703.1.41877 WP_000196703.1.42156 WP_000196703.1.4222 WP_000196703.1.42243 WP_000196703.1.4239 WP_000196703.1.42444 WP_000196703.1.42676 WP_000196703.1.43077 WP_000196703.1.43276 WP_000196703.1.43339 WP_000196703.1.43371 WP_000196703.1.43441 WP_000196703.1.43778 WP_000196703.1.43951 WP_000196703.1.44397 WP_000196703.1.44433 WP_000196703.1.44607 WP_000196703.1.449 WP_000196703.1.44933 WP_000196703.1.45145 WP_000196703.1.4540 WP_000196703.1.45434 WP_000196703.1.45582 WP_000196703.1.45622 WP_000196703.1.45706 WP_000196703.1.45781 WP_000196703.1.45848 WP_000196703.1.4592 WP_000196703.1.46205 WP_000196703.1.46278 WP_000196703.1.46323 WP_000196703.1.46434 WP_000196703.1.46572 WP_000196703.1.46930 WP_000196703.1.47008 WP_000196703.1.47506 WP_000196703.1.47579 WP_000196703.1.4770 WP_000196703.1.4775 WP_000196703.1.48268 WP_000196703.1.48493 WP_000196703.1.48855 WP_000196703.1.49012 WP_000196703.1.49113 WP_000196703.1.49175 WP_000196703.1.50251 WP_000196703.1.50404 WP_000196703.1.50905 WP_000196703.1.50999 WP_000196703.1.51066 WP_000196703.1.51224 WP_000196703.1.51555 WP_000196703.1.51831 WP_000196703.1.52170 WP_000196703.1.52336 WP_000196703.1.52692 WP_000196703.1.52744 WP_000196703.1.52866 WP_000196703.1.52949 WP_000196703.1.52985 WP_000196703.1.53272 WP_000196703.1.53905 WP_000196703.1.54469 WP_000196703.1.54522 WP_000196703.1.54526 WP_000196703.1.5456 WP_000196703.1.54814 WP_000196703.1.54845 WP_000196703.1.54992 WP_000196703.1.55073 WP_000196703.1.5523 WP_000196703.1.55325 WP_000196703.1.55430 WP_000196703.1.55557 WP_000196703.1.5560 WP_000196703.1.55706 WP_000196703.1.55853 WP_000196703.1.55973 WP_000196703.1.56026 WP_000196703.1.56244 WP_000196703.1.56559 WP_000196703.1.56647 WP_000196703.1.56660 WP_000196703.1.56950 WP_000196703.1.57000 WP_000196703.1.57125 WP_000196703.1.57356 WP_000196703.1.58358 WP_000196703.1.58407 WP_000196703.1.58442 WP_000196703.1.58698 WP_000196703.1.58749 WP_000196703.1.59335 WP_000196703.1.59420 WP_000196703.1.60209 WP_000196703.1.60545 WP_000196703.1.60561 WP_000196703.1.60772 WP_000196703.1.62020 WP_000196703.1.6209 WP_000196703.1.62245 WP_000196703.1.62257 WP_000196703.1.62271 WP_000196703.1.62339 WP_000196703.1.62344 WP_000196703.1.62564 WP_000196703.1.62619 WP_000196703.1.63186 WP_000196703.1.63797 WP_000196703.1.64018 WP_000196703.1.64121 WP_000196703.1.64387 WP_000196703.1.64569 WP_000196703.1.64690 WP_000196703.1.64894 WP_000196703.1.65269 WP_000196703.1.65940 WP_000196703.1.65956 WP_000196703.1.66049 WP_000196703.1.66122 WP_000196703.1.66289 WP_000196703.1.66330 WP_000196703.1.66678 WP_000196703.1.66937 WP_000196703.1.67 WP_000196703.1.67100 WP_000196703.1.67235 WP_000196703.1.6739 WP_000196703.1.67803 WP_000196703.1.67827 WP_000196703.1.67905 WP_000196703.1.6809 WP_000196703.1.68401 WP_000196703.1.68477 WP_000196703.1.69001 WP_000196703.1.6904 WP_000196703.1.69151 WP_000196703.1.69359 WP_000196703.1.6954 WP_000196703.1.69758 WP_000196703.1.69785 WP_000196703.1.69808 WP_000196703.1.69848 WP_000196703.1.69975 WP_000196703.1.7010 WP_000196703.1.7016 WP_000196703.1.70303 WP_000196703.1.70929 WP_000196703.1.70959 WP_000196703.1.70977 WP_000196703.1.71023 WP_000196703.1.71248 WP_000196703.1.71363 WP_000196703.1.71481 WP_000196703.1.71600 WP_000196703.1.71636 WP_000196703.1.71798 WP_000196703.1.72182 WP_000196703.1.72188 WP_000196703.1.72403 WP_000196703.1.72470 WP_000196703.1.72625 WP_000196703.1.72642 WP_000196703.1.72728 WP_000196703.1.73125 WP_000196703.1.73461 WP_000196703.1.73764 WP_000196703.1.73847 WP_000196703.1.745 WP_000196703.1.74661 WP_000196703.1.7491 WP_000196703.1.75009 WP_000196703.1.75609 WP_000196703.1.76327 WP_000196703.1.76548 WP_000196703.1.76576 WP_000196703.1.77067 WP_000196703.1.77177 WP_000196703.1.77267 WP_000196703.1.77390 WP_000196703.1.77710 WP_000196703.1.78301 WP_000196703.1.78372 WP_000196703.1.78738 WP_000196703.1.78838 WP_000196703.1.79734 WP_000196703.1.79757 WP_000196703.1.80651 WP_000196703.1.80741 WP_000196703.1.81302 WP_000196703.1.81305 WP_000196703.1.81328 WP_000196703.1.81455 WP_000196703.1.81504 WP_000196703.1.81528 WP_000196703.1.81735 WP_000196703.1.81760 WP_000196703.1.81995 WP_000196703.1.82192 WP_000196703.1.82232 WP_000196703.1.82269 WP_000196703.1.82946 WP_000196703.1.82992 WP_000196703.1.83378 WP_000196703.1.83651 WP_000196703.1.84168 WP_000196703.1.8425 WP_000196703.1.84291 WP_000196703.1.84397 WP_000196703.1.84461 WP_000196703.1.849 WP_000196703.1.85568 WP_000196703.1.85675 WP_000196703.1.86007 WP_000196703.1.86043 WP_000196703.1.86159 WP_000196703.1.86173 WP_000196703.1.86240 WP_000196703.1.8671 WP_000196703.1.87323 WP_000196703.1.87695 WP_000196703.1.87760 WP_000196703.1.87899 WP_000196703.1.8792 WP_000196703.1.87936 WP_000196703.1.88092 WP_000196703.1.88174 WP_000196703.1.88222 WP_000196703.1.88423 WP_000196703.1.88957 WP_000196703.1.88980 WP_000196703.1.88982 WP_000196703.1.88995 WP_000196703.1.89054 WP_000196703.1.89114 WP_000196703.1.89119 WP_000196703.1.89188 WP_000196703.1.89215 WP_000196703.1.89657 WP_000196703.1.89765 WP_000196703.1.89817 WP_000196703.1.90033 WP_000196703.1.91056 WP_000196703.1.91179 WP_000196703.1.91459 WP_000196703.1.91524 WP_000196703.1.91621 WP_000196703.1.91625 WP_000196703.1.92067 WP_000196703.1.92165 WP_000196703.1.92213 WP_000196703.1.92318 WP_000196703.1.92411 WP_000196703.1.92529 WP_000196703.1.92575 WP_000196703.1.92754 WP_000196703.1.92879 WP_000196703.1.92893 WP_000196703.1.93059 WP_000196703.1.93339 WP_000196703.1.93410 WP_000196703.1.93937 WP_000196703.1.94655 WP_000196703.1.94967 WP_000196703.1.94983 WP_000196703.1.95152 WP_000196703.1.95248 WP_000196703.1.95277 WP_000196703.1.95388 WP_000196703.1.95404 WP_000196703.1.95558 WP_000196703.1.95670 WP_000196703.1.95691 WP_000196703.1.95701 WP_000196703.1.95826 WP_000196703.1.95939 WP_000196703.1.96004 WP_000196703.1.96162 WP_000196703.1.96429 WP_000196703.1.96490 WP_000196703.1.96584 WP_000196703.1.9674 WP_000196703.1.96890 WP_000196703.1.97047 WP_000196703.1.97089 WP_000196703.1.97143 WP_000196703.1.97297 WP_000196703.1.97386 WP_000196703.1.97413 WP_000196703.1.97477 WP_000196703.1.97487 WP_000196703.1.97631 WP_000196703.1.9799 WP_000196703.1.98107 WP_000196703.1.98170 WP_000196703.1.9826 WP_000196703.1.99072 WP_000196703.1.99197 WP_000196703.1.99339 WP_000196703.1.99577 WP_000196703.1.99626 gi|409249749|ref|YP_006885568.1| gi|198245529|ref|YP_002215248.1| 439851.SeD_A1412 454169.SeHA_C1147 476213.SPC_2713 550538.SG1217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]