SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000428112.1.499 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000428112.1.499
Domain Number - Region: 9-75
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.0596
Family Coronavirus S2 glycoprotein 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000428112.1.499
Sequence length 100
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_000291395.1; RF=na; TAX=1053188; STAX=1396; NAME=Bacillus cereus BAG5O-1; strain=BAG5O-1; AL=Scaffold; RT=Major
Sequence
MENKEILLAITELKSSIDKRFDALEKQFDKRLDSVSEELYKIKQNLVTVDGQQSEDTQKQ
IDKIEKDIKILNQDVMFLAGKLGVHDLKLIGIENKTYIKR
Download sequence
Identical sequences K0G194
gi|407703092|ref|YP_006816240.1|NC_018689 WP_000428112.1.11380 WP_000428112.1.24992 WP_000428112.1.499 WP_000428112.1.64770 gi|407703092|ref|YP_006816240.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]