SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000448600.1.55893 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000448600.1.55893
Domain Number - Region: 36-97
Classification Level Classification E-value
Superfamily Coronavirus S2 glycoprotein 0.00481
Family Coronavirus S2 glycoprotein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000448600.1.55893
Sequence length 174
Comment MULTISPECIES: polyhydroxyalkanoic acid inclusion protein PhaP [Bacillus]; AA=GCF_000948245.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=105Ne; AL=Contig; RT=Major
Sequence
METKPYELVDAFWKNWSQSLSLFSSAGKQLEQLTLETLKQQQDALHKLTSGVNELEKELQ
QFTAQFNNQYTDYVKQLTGNSLNDQINEWQGKWNELSTQMHQLTVSPTKTSLSILTQTSG
QFEETTKHFIEQQQSQREEVQKQLEVFLGEFKSKQLELAKQFEENSKNLFTSIK
Download sequence
Identical sequences A0A1D3PEB4 A0A1K0ABN5 A0A1V6LAB9 A0A242WU70 A0A242X235 A0A2I0R9A4 C2USI2 C2V8Y0 J8KB67 K0FKA9 R8LZK4
gi|407703778|ref|YP_006827363.1| WP_000448600.1.100095 WP_000448600.1.100771 WP_000448600.1.11380 WP_000448600.1.13113 WP_000448600.1.13424 WP_000448600.1.14084 WP_000448600.1.2407 WP_000448600.1.24792 WP_000448600.1.24969 WP_000448600.1.24992 WP_000448600.1.30144 WP_000448600.1.37661 WP_000448600.1.42182 WP_000448600.1.42747 WP_000448600.1.42941 WP_000448600.1.4453 WP_000448600.1.46586 WP_000448600.1.474 WP_000448600.1.499 WP_000448600.1.52532 WP_000448600.1.54419 WP_000448600.1.55893 WP_000448600.1.60012 WP_000448600.1.64770 WP_000448600.1.65515 WP_000448600.1.66535 WP_000448600.1.70209 WP_000448600.1.75358 WP_000448600.1.75374 WP_000448600.1.77968 WP_000448600.1.84323 WP_000448600.1.86041 WP_000448600.1.89698 WP_000448600.1.92620 WP_000448600.1.93904 WP_000448600.1.94270 gi|557623382|ref|YP_008784514.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]