SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000455291.1.43714 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000455291.1.43714
Domain Number 1 Region: 27-341
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 5.81e-83
Family Glycosyl hydrolases family 32 N-terminal domain 0.0000308
Further Details:      
 
Domain Number 2 Region: 340-479
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.32e-26
Family Glycosyl hydrolases family 32 C-terminal domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000455291.1.43714
Sequence length 484
Comment sucrose-6-phosphate hydrolase [Streptococcus pneumoniae]; AA=GCF_900031755.1; RF=na; TAX=1313; STAX=1313; NAME=Streptococcus pneumoniae; strain=2842STDY5644483; AL=Scaffold; RT=Major
Sequence
MEWTTERRYRLYQDWTQEEIQHIKENMAQSPWHTHYHVEPKTGLLNDPNGFSYFDGKWIL
FYQNFPFGAAHGLKSWAQLESDDLIHFKETGIKVLPDTPLDSHGAYSGSAMQFGDNLFLF
YTGNVRDKNWIRHPYQIGALMDKEGKITKIDKILIDQPADSTDHFRDPQIFNFQGQYYAI
VGGQDLEKKGFVRLYKAVNNDYTNWQAVGDLDFANDRTAYMMECPNLVFVEEQPVLLYCP
QGLDKKVLDYDNIFPNMYKIGASFDPKNAKMVDVSQLQNMDYGFEAYATQAFNAPDGRAL
AVSWLGLPDVSYPSDRFDHQGTFSLVKELTIKDDKLYQYPVAAIKDLRASEEAFSNRSQT
KNTYELELNLEANSQSEIVLLADKEGKGLSINFDLVNGQVTVDRSQAGEQYAQEFGTTRS
CPIENQATTATIFIDNSVFEIFINKGEKVFSGRVFPHADQNGILIKSGNPTGTYYELDYG
RKTN
Download sequence
Identical sequences A0A0E7RA84 A0A0H2URG2
gi|15901557|ref|NP_346161.1| WP_000455291.1.101407 WP_000455291.1.10295 WP_000455291.1.10337 WP_000455291.1.11085 WP_000455291.1.11328 WP_000455291.1.11950 WP_000455291.1.12134 WP_000455291.1.12723 WP_000455291.1.13729 WP_000455291.1.14347 WP_000455291.1.15305 WP_000455291.1.15854 WP_000455291.1.16290 WP_000455291.1.16381 WP_000455291.1.16514 WP_000455291.1.16884 WP_000455291.1.17063 WP_000455291.1.1846 WP_000455291.1.18488 WP_000455291.1.18555 WP_000455291.1.20207 WP_000455291.1.20657 WP_000455291.1.20711 WP_000455291.1.20984 WP_000455291.1.21377 WP_000455291.1.21781 WP_000455291.1.21885 WP_000455291.1.22506 WP_000455291.1.22591 WP_000455291.1.24098 WP_000455291.1.25791 WP_000455291.1.26807 WP_000455291.1.26877 WP_000455291.1.28708 WP_000455291.1.28772 WP_000455291.1.28931 WP_000455291.1.30167 WP_000455291.1.30243 WP_000455291.1.30757 WP_000455291.1.30942 WP_000455291.1.3211 WP_000455291.1.32644 WP_000455291.1.32771 WP_000455291.1.33091 WP_000455291.1.33891 WP_000455291.1.35218 WP_000455291.1.36982 WP_000455291.1.37194 WP_000455291.1.39071 WP_000455291.1.3928 WP_000455291.1.39318 WP_000455291.1.41958 WP_000455291.1.42358 WP_000455291.1.42625 WP_000455291.1.43191 WP_000455291.1.43423 WP_000455291.1.4366 WP_000455291.1.43714 WP_000455291.1.46060 WP_000455291.1.46088 WP_000455291.1.4621 WP_000455291.1.47114 WP_000455291.1.48614 WP_000455291.1.48731 WP_000455291.1.49575 WP_000455291.1.52386 WP_000455291.1.53600 WP_000455291.1.54458 WP_000455291.1.54563 WP_000455291.1.55211 WP_000455291.1.57787 WP_000455291.1.58948 WP_000455291.1.61151 WP_000455291.1.61220 WP_000455291.1.61307 WP_000455291.1.61506 WP_000455291.1.61959 WP_000455291.1.64373 WP_000455291.1.64890 WP_000455291.1.65126 WP_000455291.1.65268 WP_000455291.1.6577 WP_000455291.1.66571 WP_000455291.1.67515 WP_000455291.1.68578 WP_000455291.1.68660 WP_000455291.1.69017 WP_000455291.1.69752 WP_000455291.1.70574 WP_000455291.1.71360 WP_000455291.1.71883 WP_000455291.1.72071 WP_000455291.1.72082 WP_000455291.1.72472 WP_000455291.1.72628 WP_000455291.1.72854 WP_000455291.1.73214 WP_000455291.1.73939 WP_000455291.1.74033 WP_000455291.1.74260 WP_000455291.1.76264 WP_000455291.1.77223 WP_000455291.1.78379 WP_000455291.1.78535 WP_000455291.1.78866 WP_000455291.1.7954 WP_000455291.1.80228 WP_000455291.1.80495 WP_000455291.1.82437 WP_000455291.1.83324 WP_000455291.1.83974 WP_000455291.1.84897 WP_000455291.1.85274 WP_000455291.1.86061 WP_000455291.1.8655 WP_000455291.1.89645 WP_000455291.1.90319 WP_000455291.1.90502 WP_000455291.1.90603 WP_000455291.1.91358 WP_000455291.1.92344 WP_000455291.1.93178 WP_000455291.1.93878 WP_000455291.1.94391 WP_000455291.1.95104 WP_000455291.1.95765 WP_000455291.1.95868 WP_000455291.1.96277 WP_000455291.1.97994 WP_000455291.1.98714 WP_000455291.1.99203 WP_000455291.1.99628 WP_000455291.1.99678 APC80588 170187.SP_1724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]