SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000625291.1.36221 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000625291.1.36221
Domain Number 1 Region: 28-126
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000053
Family SMI1/KNR4-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000625291.1.36221
Sequence length 184
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_000161555.1; RF=na; TAX=527027; STAX=1428; NAME=Bacillus thuringiensis serovar pakistani str. T13001; strain=T13001; AL=Chromosome; RT=Major
Sequence
MISPQDFLVNWNEEIYGLIHYNEKIIHSFSFSKETKDFLIKAGFPESAPPFLTFEPADNG
GGIRLSEIQNELGTMYDKFIYFGFTGSGNPICIDEAKSQLVYIDYDNENKVVLINSTIEK
FAESLLVYVEFIKEVKAANGRKAYIEKNIPKGLVEWISSALRKIDAAALTEGCFWTEELG
SFSE
Download sequence
Identical sequences A0A0D1PR82 J8L2D3
WP_000625291.1.18914 WP_000625291.1.23540 WP_000625291.1.36221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]