SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000654195.1.34867 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_000654195.1.34867
Domain Number - Region: 63-165
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0204
Family SMI1/KNR4-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_000654195.1.34867
Sequence length 168
Comment MULTISPECIES: hypothetical protein [Enterobacterales]; AA=GCF_001316615.1; RF=na; TAX=336306; STAX=550; NAME=Enterobacter cloacae subsp. cloacae; strain=ST108:941726609; AL=Contig; RT=Major
Sequence
MKDLTQLLSSLKRLMVADHYPLASPVAPEVLKDLICNPPPVEWADHKKSAYIDIQKLIKT
RLDYAQVFNAMDGFEYNGLTFYNLVQAENENLLWSNIYIRNFEARDNEIYVDPNLTDKVL
IGEDGMSLFAYSFADDCFQIRDKASTDYVIESHTEFDRFLSSLIQTVS
Download sequence
Identical sequences A0A066P6E2 A0A077W6I0 A0A0E2MHA4 A0A0F3ZBZ1 A0A0G3Q3V5 A0A0J0IHD6 A0A0K1D8T1 A0A0M6V3L2 A0A0N8LI83 A0A0S2TJA0 A0A0W2BIG2 A0A155H0L6 A0A168NAW6 A0A168UE68 A0A1C0GWS9 A0A1Y6HPM6 A0A202CYJ1 A0A222ZCX9 A0A223JZI5 A0A251ZD65 A0A286NZ24 A0A2I5I7T8 A0A2J5VGJ7 A0A2K2LRI1 A7KG42 C1IUT8 I2WXQ6 K4WQB2 Q6MXJ6
WP_000654195.1.100185 WP_000654195.1.1002 WP_000654195.1.100258 WP_000654195.1.100784 WP_000654195.1.101094 WP_000654195.1.101439 WP_000654195.1.101814 WP_000654195.1.10203 WP_000654195.1.10393 WP_000654195.1.10438 WP_000654195.1.10710 WP_000654195.1.10794 WP_000654195.1.10864 WP_000654195.1.11000 WP_000654195.1.11187 WP_000654195.1.11901 WP_000654195.1.12025 WP_000654195.1.12136 WP_000654195.1.12967 WP_000654195.1.13120 WP_000654195.1.13334 WP_000654195.1.13582 WP_000654195.1.13773 WP_000654195.1.14348 WP_000654195.1.14400 WP_000654195.1.14946 WP_000654195.1.1531 WP_000654195.1.15357 WP_000654195.1.15580 WP_000654195.1.15748 WP_000654195.1.16010 WP_000654195.1.16122 WP_000654195.1.16174 WP_000654195.1.16310 WP_000654195.1.1654 WP_000654195.1.167 WP_000654195.1.16810 WP_000654195.1.16843 WP_000654195.1.18332 WP_000654195.1.18485 WP_000654195.1.18491 WP_000654195.1.18500 WP_000654195.1.19176 WP_000654195.1.19389 WP_000654195.1.19404 WP_000654195.1.19459 WP_000654195.1.19666 WP_000654195.1.19678 WP_000654195.1.20063 WP_000654195.1.20450 WP_000654195.1.20556 WP_000654195.1.20871 WP_000654195.1.21086 WP_000654195.1.21439 WP_000654195.1.21541 WP_000654195.1.21649 WP_000654195.1.22374 WP_000654195.1.22537 WP_000654195.1.2264 WP_000654195.1.2282 WP_000654195.1.23279 WP_000654195.1.23521 WP_000654195.1.23558 WP_000654195.1.23869 WP_000654195.1.24215 WP_000654195.1.25654 WP_000654195.1.26028 WP_000654195.1.26147 WP_000654195.1.26356 WP_000654195.1.26530 WP_000654195.1.26654 WP_000654195.1.2675 WP_000654195.1.27545 WP_000654195.1.27641 WP_000654195.1.28126 WP_000654195.1.29612 WP_000654195.1.29739 WP_000654195.1.30412 WP_000654195.1.31249 WP_000654195.1.31268 WP_000654195.1.31327 WP_000654195.1.31622 WP_000654195.1.31891 WP_000654195.1.32860 WP_000654195.1.32958 WP_000654195.1.33632 WP_000654195.1.33797 WP_000654195.1.34481 WP_000654195.1.34788 WP_000654195.1.34825 WP_000654195.1.34867 WP_000654195.1.34977 WP_000654195.1.35259 WP_000654195.1.35511 WP_000654195.1.35999 WP_000654195.1.36474 WP_000654195.1.36719 WP_000654195.1.36758 WP_000654195.1.37308 WP_000654195.1.37401 WP_000654195.1.37462 WP_000654195.1.37687 WP_000654195.1.38110 WP_000654195.1.38635 WP_000654195.1.39380 WP_000654195.1.39553 WP_000654195.1.39581 WP_000654195.1.39817 WP_000654195.1.39855 WP_000654195.1.39969 WP_000654195.1.40063 WP_000654195.1.40441 WP_000654195.1.40693 WP_000654195.1.41014 WP_000654195.1.41651 WP_000654195.1.41859 WP_000654195.1.41953 WP_000654195.1.42163 WP_000654195.1.43187 WP_000654195.1.43656 WP_000654195.1.43909 WP_000654195.1.43992 WP_000654195.1.44422 WP_000654195.1.44522 WP_000654195.1.44578 WP_000654195.1.44791 WP_000654195.1.44996 WP_000654195.1.45288 WP_000654195.1.45462 WP_000654195.1.4616 WP_000654195.1.46292 WP_000654195.1.46299 WP_000654195.1.46415 WP_000654195.1.46600 WP_000654195.1.46853 WP_000654195.1.4737 WP_000654195.1.47788 WP_000654195.1.48760 WP_000654195.1.48827 WP_000654195.1.49097 WP_000654195.1.49440 WP_000654195.1.49441 WP_000654195.1.49473 WP_000654195.1.49650 WP_000654195.1.49836 WP_000654195.1.49923 WP_000654195.1.49946 WP_000654195.1.50349 WP_000654195.1.50370 WP_000654195.1.50858 WP_000654195.1.5158 WP_000654195.1.52303 WP_000654195.1.52388 WP_000654195.1.52556 WP_000654195.1.52764 WP_000654195.1.52918 WP_000654195.1.52938 WP_000654195.1.53436 WP_000654195.1.54584 WP_000654195.1.54846 WP_000654195.1.54933 WP_000654195.1.5612 WP_000654195.1.562 WP_000654195.1.5638 WP_000654195.1.56583 WP_000654195.1.56757 WP_000654195.1.57232 WP_000654195.1.57317 WP_000654195.1.57771 WP_000654195.1.5854 WP_000654195.1.59053 WP_000654195.1.59408 WP_000654195.1.5953 WP_000654195.1.59627 WP_000654195.1.59818 WP_000654195.1.60053 WP_000654195.1.60141 WP_000654195.1.60161 WP_000654195.1.60348 WP_000654195.1.60748 WP_000654195.1.60802 WP_000654195.1.60951 WP_000654195.1.62024 WP_000654195.1.62117 WP_000654195.1.62452 WP_000654195.1.62469 WP_000654195.1.62682 WP_000654195.1.63227 WP_000654195.1.64183 WP_000654195.1.64209 WP_000654195.1.65377 WP_000654195.1.65764 WP_000654195.1.65877 WP_000654195.1.66160 WP_000654195.1.6651 WP_000654195.1.66600 WP_000654195.1.66660 WP_000654195.1.68071 WP_000654195.1.68694 WP_000654195.1.68950 WP_000654195.1.69196 WP_000654195.1.70432 WP_000654195.1.70469 WP_000654195.1.7068 WP_000654195.1.71173 WP_000654195.1.71445 WP_000654195.1.71528 WP_000654195.1.72717 WP_000654195.1.72878 WP_000654195.1.73062 WP_000654195.1.73596 WP_000654195.1.73667 WP_000654195.1.73926 WP_000654195.1.74068 WP_000654195.1.74744 WP_000654195.1.75359 WP_000654195.1.75531 WP_000654195.1.75660 WP_000654195.1.7569 WP_000654195.1.76308 WP_000654195.1.76349 WP_000654195.1.76700 WP_000654195.1.77211 WP_000654195.1.77324 WP_000654195.1.77419 WP_000654195.1.77438 WP_000654195.1.77950 WP_000654195.1.78555 WP_000654195.1.79019 WP_000654195.1.79105 WP_000654195.1.79247 WP_000654195.1.79753 WP_000654195.1.80110 WP_000654195.1.80176 WP_000654195.1.8078 WP_000654195.1.8094 WP_000654195.1.81363 WP_000654195.1.8186 WP_000654195.1.83365 WP_000654195.1.8355 WP_000654195.1.83680 WP_000654195.1.83903 WP_000654195.1.84229 WP_000654195.1.84817 WP_000654195.1.84890 WP_000654195.1.85031 WP_000654195.1.85855 WP_000654195.1.86114 WP_000654195.1.86155 WP_000654195.1.86396 WP_000654195.1.86517 WP_000654195.1.87337 WP_000654195.1.87491 WP_000654195.1.87633 WP_000654195.1.88274 WP_000654195.1.88938 WP_000654195.1.9002 WP_000654195.1.90455 WP_000654195.1.90856 WP_000654195.1.91200 WP_000654195.1.91359 WP_000654195.1.91599 WP_000654195.1.92050 WP_000654195.1.92060 WP_000654195.1.92171 WP_000654195.1.92332 WP_000654195.1.92372 WP_000654195.1.93275 WP_000654195.1.93939 WP_000654195.1.94238 WP_000654195.1.9436 WP_000654195.1.94436 WP_000654195.1.94984 WP_000654195.1.95582 WP_000654195.1.95990 WP_000654195.1.96082 WP_000654195.1.9610 WP_000654195.1.96157 WP_000654195.1.96190 WP_000654195.1.96919 WP_000654195.1.97251 WP_000654195.1.97605 WP_000654195.1.98165 WP_000654195.1.98229 WP_000654195.1.98325 WP_000654195.1.9837 WP_000654195.1.98949 WP_000654195.1.99422 WP_000654195.1.99883 WP_000654195.1.99951 gi|190410349|ref|YP_001965852.1|NC_010870 gi|226807759|ref|YP_002791455.1|NC_012555 gi|226810073|ref|YP_002791768.1|NC_012556 gi|38348022|ref|NP_941271.1|NC_005211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]