SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000665936.1.31221 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000665936.1.31221
Domain Number 1 Region: 13-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 8.11e-31
Family SMI1/KNR4-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000665936.1.31221
Sequence length 140
Comment MULTISPECIES: 1,3-beta-glucan synthase regulator [Bacillus]; AA=GCF_000773635.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=tsu1; AL=Scaffold; RT=Major
Sequence
MKEVREYIETKKQGVLELQIKETEEKLGAAFPNQYRDLIKLVNNAEIGEWILYPIKDNRN
VTKTWDDIVRQNVDMRDEYMPENLIIIGDDGSGDKLCFKINNGKMDDEIYIWYHADDEME
EISPSLKEFIMETIQEDDVF
Download sequence
Identical sequences A0A0K0S9J6 A0A160HDJ2 A0A193CU42 A0A1G1UHJ8 B5UUA7 C2WNY0 C2XD11 G9Q8G9 J7Z720
WP_000665936.1.101224 WP_000665936.1.24795 WP_000665936.1.26826 WP_000665936.1.26965 WP_000665936.1.31221 WP_000665936.1.35694 WP_000665936.1.40430 WP_000665936.1.43442 WP_000665936.1.44428 WP_000665936.1.47000 WP_000665936.1.47437 WP_000665936.1.51681 WP_000665936.1.55077 WP_000665936.1.58586 WP_000665936.1.61243 WP_000665936.1.6475 WP_000665936.1.6816 WP_000665936.1.71242 WP_000665936.1.72484 WP_000665936.1.7593 WP_000665936.1.77567

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]