SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000689180.1.33828 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000689180.1.33828
Domain Number 1 Region: 180-464
Classification Level Classification E-value
Superfamily Subtilisin-like 3.01e-36
Family Subtilases 0.00047
Further Details:      
 
Domain Number 2 Region: 503-612
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.83e-32
Family Collagen-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000689180.1.33828
Sequence length 613
Comment collagenase [Bacillus thuringiensis]; AA=GCF_000832825.1; RF=na; TAX=1428; STAX=1428; NAME=Bacillus thuringiensis; strain=HD571; AL=Complete Genome; RT=Major
Sequence
MKIFQKMCASTVIITTLLGIGGTVNSVHADSIEQQSKLGIDQETDKHIIVKFKADLKFPY
EDGIEKQIQSQTNDKVLEDLLVEYPDVTFTRLFTSVSPEEIEDLEVKAPNNVSTSLLNYY
ILQTQNGEQKEELVDRLKKSSLIEDVYMKKQEKITPPEVQPSSVSLSPNNNPRFKQQGYL
EAAPYGINAPFAWEVQGGKGSGITFVDMEYGWLLNHEDLVHQNIELMSGRNIDQHVGHGT
SVLGIVSSEDNEVGNIGIAPKAKAKVISQIRDNGQYNTADAILSAVNQLEAGDVLLLEAQ
ASFDGYGDKYLPVEIQPDIFDAIRAGTDKGVVIIEAGANGWNDLDQFKDRNGKQVLNRNS
KDFKDSGAIMVGAGSSSFPHERMWFSNYGSRIDVYGWGENVDTTTAEQSRSAVNLYTSSF
SGTSSASPIIAGAATLVQSIAKENLGRPYRPSELRAILSNENTGTKSKNPYADQIGVLPD
LKSILVNLGYGQRKPNGGNELQVTENEPNNERIQANKVNFHTPMKGTLHNSDRVDVFTFQ
MDSPENITISLLNEQNIGMTWVLHHESDLNNYVAYGENEGNVVKGTYHAKPGKYYLYVYK
YENKDGSYVLNIK
Download sequence
Identical sequences A0RHD3
gi|118478982|ref|YP_896133.1| WP_000689180.1.33828 WP_000689180.1.46476 412694.BALH_3389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]