SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000689184.1.7545 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000689184.1.7545
Domain Number 1 Region: 180-463
Classification Level Classification E-value
Superfamily Subtilisin-like 3.93e-36
Family Subtilases 0.00047
Further Details:      
 
Domain Number 2 Region: 503-612
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.83e-32
Family Collagen-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000689184.1.7545
Sequence length 613
Comment peptidase [Bacillus cereus]; AA=GCF_000021785.1; RF=na; TAX=405535; STAX=1396; NAME=Bacillus cereus AH820; strain=AH820; AL=Complete Genome; RT=Major
Sequence
MKIFQKMCASTVIITTLLGIGGTVNSVHADSIEQQSKLGIDQETDKQIIVKFKADLKFPY
EDGIEKQIQSQTNDKVLEDLLVEYPDVTFTRLFTSVSPEEIEDLEVKAPNNVSTSLLNYY
ILQTQNGEQKEELVDRLKKSCLIEDVYMKKQEKITPPEVQPSSVSLSPNNNPRFKQQGYL
EAAPYGINVPFAWEVQGGKGSGITFVDMEYGWLLNHEDLVHQNIELMSGINIDQHVGHGT
SVLGIVSSEDNEVGNIGIAPKAKAKVISQIRDNGQYNTADAILSAVNQLEAGDVLLLEAQ
ASFDGYGDKYLPVEVQPDIFDAIRAGTDKGVVIIEAGANGWNDLDQFKDRNGKQILNRNS
KDFKDSGAIMVGAGSSSFPHERMWFSNYGSRIDVYGWGENVDTTTAEQSRSAVNLYTSSF
SGTSSASPIIAGAATLVQSIAKENLGQPYRPSELRAILSNENTGTKSKDPYADQIGVLPD
LKSILVNLGYGQRKPNGGNELQVTENEPNNERIQANKVNFHTPMKGTLHNSDRVDVFTFQ
MDSPENITISLLNEQNIGMTWVLHHESDLNNYVAYGENEGNVVKGTYHAKPGKYYLYVYK
YENKDGSYVLNIK
Download sequence
Identical sequences B7JJ39
405535.BCAH820_3772 gi|218904889|ref|YP_002452723.1| WP_000689184.1.7545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]