SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000703156.1.11387 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000703156.1.11387
Domain Number 1 Region: 35-197
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-28
Family Beta-D-xylosidase C-terminal domain-like 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000703156.1.11387
Sequence length 198
Comment MULTISPECIES: hypothetical protein [Bacillus cereus group]; AA=GCF_001044585.1; RF=na; TAX=1396; STAX=1396; NAME=Bacillus cereus; strain=HWW 274-2; AL=Scaffold; RT=Major
Sequence
MKISHIPEHIEQLTIMNVPEYYKLNNNHALIVRSKAETDFWLKTHYGFQVMNGHVFYTET
MTDFQAEVQLRMNPNSKFDQAGLFVMISEKCWLKTSLEYIPDGPSHLGAVVTNNGYSDWS
TQDFPTELANEQLRFRIVRKRGDYTIYVKKIHQWEQIRIAHLMEDIGNKPIKIGFYTCSP
SKNNGFETEFLEFTTENI
Download sequence
Identical sequences A0A0K6N2B1 A0A150B0K2 A0A1Q4LZY2 D8GXX9 Q81QI3
gi|30262441|ref|NP_844818.1| 198094.BA_2442 261594.GBAA2442 568206.BAMEG_2158 592021.BAA_2500 gi|47778046|ref|YP_019083.2| gi|301053953|ref|YP_003792164.1| gi|227814748|ref|YP_002814757.1| gi|229604108|ref|YP_002866769.1| NP_844818.1.87267 WP_000703156.1.11387 WP_000703156.1.33536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]