SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000746488.1.27987 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000746488.1.27987
Domain Number 1 Region: 44-764
Classification Level Classification E-value
Superfamily Anthrax protective antigen 6.28e-275
Family Anthrax protective antigen 3.3e-18
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_000746488.1.27987
Sequence length 764
Comment peptidase [Bacillus anthracis]; AA=GCF_000783115.1; RF=na; TAX=1392; STAX=1392; NAME=Bacillus anthracis; strain=2000032951; AL=Scaffold; RT=Major
Sequence
MKKRKVLIPLMALSTILVSSTGNLEVIQAEVKQENRLLNESESSSQGLLGYYFSDLNFQA
PMVVTSSTTGDLSIPSSELENIPSENQYFQSAIWSGFIKVKKSDEYTFATSADNHVTMWV
DDQEVINKASNSNKIRLEKGRLYQIKIQYQRENPTEKGLDFKLYWTDSQNKKEVISSDNL
QLPELKQKSSNSRKKRSTSAGPTVPDRDNDGIPDSLEVEGYTVDVKNKRTFLSPWISNIH
EKKGLTKYKSSPEKWSTASDPYSDFEKVTGRIDKNVSPEARHPLVAAYPIVHVDMENIIL
SKNEDQSTQNTDSQTRTISKNTSTSRTHTSEVHGNAEVHASFFDIGGSVSAGFSNSNSST
VAIDHSLSLAGERTWAETMGLNTADTARLNANIRYVNTGTAPIYNVLPTTSLVLGKNQTL
ATIKAKENQLSQILAPNNYYPSKNLAPIALNAQDDFSSTPITMNYNQFLELEKTKQLRLD
TDQVYGNIATYNFENGRVRVDTGSNWSEVLPQIQETTARIIFNGKDLNLVERRIAAVNPS
DPLETTKPDMTLKEALKIAFGFNESNGNLQYQGKDITEFDFNFDQQTSQNIKNQLAELNV
TNIYTVLDKIKLNAKMNILIRDKRFHYDRNNIAVGADESVVKEAHREVINSSTEGLLLNI
DKDIRKILSGYIVEIEDTEGLKEVINDRYDMLNISSLRQDGKTFIDFKKYNDKLPLYISN
PNYKVNVYAVTKENTIINPSENGDTSTNGIKKILIFSKKGYEIG
Download sequence
Identical sequences 568206.BAMEG_A0160 gi|227811585|ref|YP_002811596.1| gi|227811585|ref|YP_002811596.1|NC_012579 WP_000746488.1.19435 WP_000746488.1.21021 WP_000746488.1.24608 WP_000746488.1.27987 WP_000746488.1.29101 WP_000746488.1.54117 WP_000746488.1.56042 WP_000746488.1.59575 WP_000746488.1.68607 WP_000746488.1.69203 WP_000746488.1.69822 WP_000746488.1.88641 WP_000746488.1.90791 WP_000746488.1.93927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]