SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000781562.1.16170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000781562.1.16170
Domain Number 1 Region: 180-463
Classification Level Classification E-value
Superfamily Subtilisin-like 1.02e-35
Family Subtilases 0.00043
Further Details:      
 
Domain Number 2 Region: 503-612
Classification Level Classification E-value
Superfamily Collagen-binding domain 1.83e-32
Family Collagen-binding domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000781562.1.16170
Sequence length 613
Comment serine protease [Bacillus anthracis]; AA=GCF_900014375.1; RF=na; TAX=1392; STAX=1392; NAME=Bacillus anthracis; AL=Contig; RT=Major
Sequence
MKMFQKMCASTVIITTLLGIGGTVNSVHADSIEQQSKLGIDQETDKQIIVKFKADLKFPY
EDGIEKQIQSQTNDKVLEDLLVEYPDVTFTRLFTSVSPEEIEDLEVKAPNNVSTSLLNYY
ILQTQNGEQKEELVDRLKKSCLIEDVYMKKQEKITPPEVQPSSVSLSPNNNPRFKQQGYL
EAAPYGINAPFAWEVQGGKGSGITFVDMEYGWLLNHEDLVHQNIELMSGINIDQHVGHGT
SVLGIVSSEDNEVGNIGIAPKAKAKVISQIRDNGQYNTADAILSAVNQLEAGDVLLLEAQ
ASFDGYGDKYLPVEVQPDIFDAIRAGTDKGVVIIEAGANGWNDLDQFKDRNGKQILNRNS
KDFKDSGAIMVGAGSSSFPHGRMWFSNYGSRIDVYGWGENVDTTTAEQSRSAVNLYTSSF
SGTSSASPIIAGAATLVQSIAKENLGQPYRPSELRAILSNENTGTKSKDPYADQIGVLPD
LKSILVNLGYGQRKPNGGNELQVTENEPNNERIQANKVNFHTPMKGTLHNSDRVDVFTFQ
MDSPENITISLLNEQNIGMTWVLHHESDLNNYVAYGENEGNVVKGTYHAKPGKYYLYVYK
YENKDGSYVLNIK
Download sequence
Identical sequences A0A0F7R867 Q81WS6
gi|229604789|ref|YP_002867998.1| gi|227813336|ref|YP_002813345.1| gi|47529180|ref|YP_020529.1| gi|49186606|ref|YP_029858.1| gi|30263762|ref|NP_846139.1| gi|386737579|ref|YP_006210760.1| NP_846139.1.87267 WP_000781562.1.100214 WP_000781562.1.100595 WP_000781562.1.10208 WP_000781562.1.11427 WP_000781562.1.11676 WP_000781562.1.13115 WP_000781562.1.13233 WP_000781562.1.13820 WP_000781562.1.14721 WP_000781562.1.14855 WP_000781562.1.15460 WP_000781562.1.15569 WP_000781562.1.16170 WP_000781562.1.16997 WP_000781562.1.17146 WP_000781562.1.18976 WP_000781562.1.19258 WP_000781562.1.19435 WP_000781562.1.19445 WP_000781562.1.20390 WP_000781562.1.20680 WP_000781562.1.21021 WP_000781562.1.21258 WP_000781562.1.21776 WP_000781562.1.22865 WP_000781562.1.23269 WP_000781562.1.2419 WP_000781562.1.24334 WP_000781562.1.24556 WP_000781562.1.24608 WP_000781562.1.25716 WP_000781562.1.25752 WP_000781562.1.2618 WP_000781562.1.26665 WP_000781562.1.26721 WP_000781562.1.27644 WP_000781562.1.27987 WP_000781562.1.28427 WP_000781562.1.28729 WP_000781562.1.29101 WP_000781562.1.29787 WP_000781562.1.30110 WP_000781562.1.31490 WP_000781562.1.3236 WP_000781562.1.32576 WP_000781562.1.33175 WP_000781562.1.33338 WP_000781562.1.33367 WP_000781562.1.33740 WP_000781562.1.33876 WP_000781562.1.34646 WP_000781562.1.35684 WP_000781562.1.35886 WP_000781562.1.36305 WP_000781562.1.36763 WP_000781562.1.38036 WP_000781562.1.39781 WP_000781562.1.40550 WP_000781562.1.41165 WP_000781562.1.41675 WP_000781562.1.4439 WP_000781562.1.45305 WP_000781562.1.45533 WP_000781562.1.46236 WP_000781562.1.46699 WP_000781562.1.47145 WP_000781562.1.4763 WP_000781562.1.47798 WP_000781562.1.51749 WP_000781562.1.52794 WP_000781562.1.53137 WP_000781562.1.53493 WP_000781562.1.53683 WP_000781562.1.54117 WP_000781562.1.54189 WP_000781562.1.55811 WP_000781562.1.55958 WP_000781562.1.56042 WP_000781562.1.56176 WP_000781562.1.56270 WP_000781562.1.56959 WP_000781562.1.58160 WP_000781562.1.59095 WP_000781562.1.59310 WP_000781562.1.59575 WP_000781562.1.60402 WP_000781562.1.61213 WP_000781562.1.63560 WP_000781562.1.68607 WP_000781562.1.69822 WP_000781562.1.69894 WP_000781562.1.70065 WP_000781562.1.70996 WP_000781562.1.72704 WP_000781562.1.73325 WP_000781562.1.74226 WP_000781562.1.74538 WP_000781562.1.75499 WP_000781562.1.75870 WP_000781562.1.76125 WP_000781562.1.76783 WP_000781562.1.77668 WP_000781562.1.77824 WP_000781562.1.78644 WP_000781562.1.79315 WP_000781562.1.79584 WP_000781562.1.80439 WP_000781562.1.80695 WP_000781562.1.81799 WP_000781562.1.82289 WP_000781562.1.83951 WP_000781562.1.84045 WP_000781562.1.85689 WP_000781562.1.86119 WP_000781562.1.86140 WP_000781562.1.86239 WP_000781562.1.86288 WP_000781562.1.8698 WP_000781562.1.8825 WP_000781562.1.88641 WP_000781562.1.90791 WP_000781562.1.90883 WP_000781562.1.9186 WP_000781562.1.92686 WP_000781562.1.92831 WP_000781562.1.93271 WP_000781562.1.93744 WP_000781562.1.93927 WP_000781562.1.94237 WP_000781562.1.94322 WP_000781562.1.94784 WP_000781562.1.96934 WP_000781562.1.97781 WP_000781562.1.97861 WP_000781562.1.98216 WP_000781562.1.99445 WP_000781562.1.99485 WP_000781562.1.99994 YP_029858.1.16718 IDP02439 198094.BA_3892 260799.BAS3605 261594.GBAA3892 568206.BAMEG_0740 592021.BAA_3916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]