SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_000843107.1.2206 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_000843107.1.2206
Domain Number 1 Region: 10-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 2.75e-28
Family SMI1/KNR4-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_000843107.1.2206
Sequence length 156
Comment MULTISPECIES: SMI1/KNR4 family protein [Bacillus]; AA=GCF_002147375.1; RF=na; TAX=52024; STAX=1428; NAME=Bacillus thuringiensis serovar wuhanensis; strain=BGSC 4T1; AL=Contig; RT=Major
Sequence
MKSTIWADDDYLKLAPINDELIKKAEEVLNVKLPESYINLLKEQNGGTLRLDVHPTSKPN
SWADDHVNVSGLYGISFDENESSILESRYLIREWEMPENIILLSGDGHTWIALDYRNVAE
NPPVIFIDNEFEEIIELAPNFESFLQNLTTYEYDEE
Download sequence
Identical sequences A0A0F6G0N2 A0A0T8Y4L3 A0A0W7Y924 A0A231HUA1 A0A2B8GPV5 C2XIM5 R8L4L9 R8P673
WP_000843107.1.10845 WP_000843107.1.1112 WP_000843107.1.18749 WP_000843107.1.19516 WP_000843107.1.2206 WP_000843107.1.23307 WP_000843107.1.27106 WP_000843107.1.29836 WP_000843107.1.29993 WP_000843107.1.34175 WP_000843107.1.34587 WP_000843107.1.37239 WP_000843107.1.38427 WP_000843107.1.38591 WP_000843107.1.4185 WP_000843107.1.41879 WP_000843107.1.42167 WP_000843107.1.42218 WP_000843107.1.43767 WP_000843107.1.44497 WP_000843107.1.49455 WP_000843107.1.49702 WP_000843107.1.50694 WP_000843107.1.51047 WP_000843107.1.54777 WP_000843107.1.55077 WP_000843107.1.5543 WP_000843107.1.58632 WP_000843107.1.63743 WP_000843107.1.64764 WP_000843107.1.674 WP_000843107.1.6743 WP_000843107.1.68007 WP_000843107.1.68346 WP_000843107.1.69501 WP_000843107.1.70181 WP_000843107.1.74372 WP_000843107.1.74832 WP_000843107.1.74857 WP_000843107.1.74976 WP_000843107.1.76883 WP_000843107.1.77386 WP_000843107.1.81000 WP_000843107.1.83694 WP_000843107.1.83977 WP_000843107.1.85928 WP_000843107.1.87013 WP_000843107.1.87725 WP_000843107.1.89009 WP_000843107.1.90665 WP_000843107.1.9860 gi|449091970|ref|YP_007424411.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]